SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000114406 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000114406
Domain Number 1 Region: 593-995
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.09e-109
Family PIWI domain 0.0048
Further Details:      
 
Domain Number 2 Region: 310-616
Classification Level Classification E-value
Superfamily PAZ domain 5.18e-77
Family PAZ domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000114406   Gene: ENSDARG00000062601   Transcript: ENSDART00000134274
Sequence length 1087
Comment pep:novel chromosome:Zv9:5:18209517:18253045:-1 gene:ENSDARG00000062601 transcript:ENSDART00000134274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPKRPTFPSPPGVIRAPWQQSTEDQSQLLDQPSLGRARGLIMPIDEPLPGRGRAFSVPG
EMPVRFGRGITQSIAAEPLVGMARGVRLPMEEGGFGRGRGFLLPTPEPTVGIGRGAAIGP
VPTLDIQKAEVEEKMPELQAEVAPTVAKVGSPGTGSSLVSMFRGLGIEPGKTWGRGAAPV
GRGAAGDMGADLQPKPTIIGASLTPEREEVRSEESISFLGRGFTGFGRAAMPHMTVGRGP
IGPLSPSPSVAAPFSLISASSASEDAPVAPGTPPKVEVKIETVKEPLQKIGTKGSPIPIG
SNYIPICCKNDAVFQYHVTFTPNVESLSMRFGMMKEHRPTTGEVVAFDGSILYLPKRLEE
VVHLKAERKTDNQEIDIKIQLTKILPPSSDLCIPFYNVVLRRVMKILGLKLVGRNHYDPN
AVVILGKHRLQVWPGYSTSIKHTDGGLYLVVDVSHKVLRNDSVLDVMNLIYQGSRESFQD
ECTKEFVGSIVITRYNNRTYRIDDIEWSKSPKDTFTLADGSVTTFVDYYRKNYGITIKEL
DQPLLIHRPKERSRPGGKVITGEILLLPELSFMTGIPEKMRKDFRAMKDLTMHINVGAQQ
HTQSLKQLLHNINSNNEALSELGRWGLSISQEILVTQGRTLPSETICLHSASFVTSPAVD
WSRELVRDPSISTVPLNCWAVFYPRRATDQAEELVTTFSRVAGPMGMRVERPIRVELRDD
RTETFVKSIHSQLTSEPRVQLVVCIMTGNRDDLYSAIKKLCCIQSPVPSQAINVRTISQP
QKLRSVAQKILLQINCKLGGELWTVNVPLKYLMVIGVDVHHDTSKKSRSVMGFVASLNSM
LTKWYSRVTFQMPNEEIINGFRVCLLAALQKYYEVNHAFPEKIVIYRDGVSDGQLKTVEH
YEIPQILKCFETIPNYEPKLAFIVVQKRISTTLYSYGSDHFGTPSPGTVLDHTVTNRDWV
DFYLMAHSIRQGCGLPTHYITVYNTANLTPDHLQRYEVVGIQNVDLQDVSPVLELAWNNT
RSCTVQICPQTGFPVWPVPPFRACNPAVRETVFSVNERHSASQQNPGWVRPLTFVLSFVL
ILFLGKC
Download sequence
Identical sequences T1ECU4
ENSDARP00000114406 ENSDARP00000114406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]