SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000115103 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000115103
Domain Number 1 Region: 532-702
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-45
Family SPRY domain 0.00023
Further Details:      
 
Domain Number 2 Region: 305-371
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000488
Family B-box zinc-binding domain 0.002
Further Details:      
 
Domain Number 3 Region: 7-58
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000919
Family RING finger domain, C3HC4 0.041
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000115103
Domain Number - Region: 357-454
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0549
Family Apolipoprotein A-I 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000115103   Gene: ENSDARG00000017173   Transcript: ENSDART00000136172
Sequence length 717
Comment pep:known chromosome:Zv9:18:27282361:27303238:1 gene:ENSDARG00000017173 transcript:ENSDART00000136172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAANEKALKCPLCHEDCRDQVTLGCGHSFCQSCIKELWSGSRTGPYYCPECRYEYQQLP
DYTDRASTSTATPITHWPLGKKLYKQHSKKWHKKRKFFSAFPGDGFRLGVSTGSFNFNDV
INIADSDEDTSAIPKKRRATADEHPSESQSSSVLRRSTSTSDTSTQCTPPEISETTSPQA
ESSPDRTSSSQQVPLASHNDMDSPRESNTPPTTSSKASETPTFNANSDSPGRQESHNTLN
LEDGLGVSAVSPERLSRNSSVPCHYCPSSEQKVAVKTCLVCGASMCSEHLRDHLEKPVFK
SHPLVNAVEDVSLWRCQEHQEMNRIYCRSCAVCVCTVCSLVGLHKGHECISIREAEQQLR
GSLKDEMQKLQTTEKSIQEKVSELSEKKHCVQSELEEVRAAVLQQYHAMQEALEQEQEQA
LLCVSQEENRVLGSIEKQLHTLQGALMSSQSILNTLQGMTNNEGASQYQDQAFIMEYSKI
AGQLTGLSDPVQNFRAPQEINQERLECLHEWTERRLETVLISLPHRDPFRLLYGISPTLD
PDTVHPKLLLSNENRMVQYSETQQDYSEHEARFNIFPQVLGSDAIERGCCYWEVEVSLDE
GRWKVGACDGRIGRKGQKDVCRIGFYPNSWCLIYEKGKVEALHDKVASPVCATDLQKVGV
LLNLNEGRLSFYSVARDGALSLLYSFEHTFSEPLYPALAVSKTQVSICDVFSKSVAE
Download sequence
Identical sequences A3KQE0
ENSDARP00000115103 XP_700212.1.45394 7955.ENSDARP00000089096 ENSDARP00000115103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]