SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000115448 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000115448
Domain Number 1 Region: 363-530
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-44
Family SPRY domain 0.00093
Further Details:      
 
Domain Number 2 Region: 7-82
Classification Level Classification E-value
Superfamily RING/U-box 3.77e-21
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 134-200
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.94e-16
Family B-box zinc-binding domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000115448   Gene: ENSDARG00000029105   Transcript: ENSDART00000132323
Sequence length 530
Comment pep:novel chromosome:Zv9:4:60400904:60407959:1 gene:ENSDARG00000029105 transcript:ENSDART00000132323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEARISQDEFTCPVCLDLLKHPAAIPCGHSYCKSCITDCWDQEEEKGVYSCPQCRQTFS
LRPALAKNTILAEVVEKLKKTKPPADCCAGDVPCDVCTGGKYTAVKSCLVCLSSYCESHL
EQHESLFKGKRHRLTEATGRLQEMICHDHDKLLEVFCRTDQKCICLLCTMDEHKNHDTVS
AAAQRTESQKQMKETQSKIQERIQQRERDLQQLKEAVESHKRSAQTAVEDTKRIFTELIQ
HIERSRSEVTRQIRDQEKSAVSRAEEGLERMQQEINELRRTDEELEQLSEIQDPVHFLQN
FQTLSASPKSTAVTDNPLRFLNSFDGMRESIQQLGQTLQNLCREELQKTSGKSSVTNTIP
KTRKDFLQYSLQLTLDPNTVNEHLHLSNGNRAVNGSLKAWPYPDHPERFEELQVLCRESV
CGRGYWEIEWRGDYVSIVVSYKRICRKGPGREHYFGGNDLSWSLESSNYEYTFRHNNIET
ELPANPLSLCHRIGVFVDHSAGTLIFYNIYRDTMSLIHSVQTTFTEPLYP
Download sequence
Identical sequences ENSDARP00000115448 ENSDARP00000115448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]