SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000115584 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000115584
Domain Number 1 Region: 367-545
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-68
Family SPRY domain 0.00000505
Further Details:      
 
Domain Number 2 Region: 32-105
Classification Level Classification E-value
Superfamily RING/U-box 2.1e-20
Family RING finger domain, C3HC4 0.0071
Further Details:      
 
Domain Number 3 Region: 154-220
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.29e-17
Family B-box zinc-binding domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000115584   Gene: ENSDARG00000095500   Transcript: ENSDART00000132370
Sequence length 549
Comment pep:novel chromosome:Zv9:19:4870909:4879273:1 gene:ENSDARG00000095500 transcript:ENSDART00000132370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESSPTSTKGKETWRGSQDVLPPYMSSSSNPLSEELQCSICLEVFTDPVSTPCGHNFCK
SCLNKCWNNSQTCSCPYCKETFRHRPDLKINTTLREISEHYKEKKPEEKAEVVCDVCEDR
KLKALKSCLVCQSSYCQTHLERHLRVAGLKKHKLMDPVRNLEDYICQKHDRPLELFCRDD
QTCVCSFCIEKDHENHNTVPLEEESKEKKTELMKTQKDVQQMIQDRIKKIQDVKHSAGVR
KINSEKEKATHVEIFTDLIRAIERCQTELLEMMEEQQKAAEKQEEELIEELEQEITELKM
RNTELEQLSHTEDHLHLLQSYSSLHRAADTRNWPEISLKTQENLETLRRALNTLKDTVEE
KITQTELKWKQQYAVDVTLDPDTAHPKLILSDDGKQVRCGDIRQELPDTPQRFDYCPCVL
GKEGFSSGRFYYEVQVKGKTDWDLGVARESINRKGKITLTPGNGFCTVWLRKENECFSLS
LKVKPQRVGVFVDYEEGLVSFYDVESSSHIYSFTDQTFTDKLYPYFSPCPNYEGKNSNPL
IITPVNYNK
Download sequence
Identical sequences XP_017207880.1.45394 ENSDARP00000115584 ENSDARP00000115584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]