SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000116281 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000116281
Domain Number 1 Region: 29-135
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.96e-23
Family Hormone receptor domain 0.00047
Further Details:      
 
Domain Number 2 Region: 115-398
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000522
Family Rhodopsin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000116281   Gene: ENSDARG00000059058   Transcript: ENSDART00000143759
Sequence length 446
Comment pep:novel chromosome:Zv9:24:21316626:21416735:-1 gene:ENSDARG00000059058 transcript:ENSDART00000143759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDASKVVLLASAFGFVFSPVAAVQMCDVVNEIELARARCENKTAGNVTSGCKGMWDIIAC
WPSAKIGEHVVIPCPNYFRHFSDQHEGNLSKTCTADGWTEMDSLEIAVNCGYNLNGTVDD
DSFFRSVKIGYTIGHSVSLISLTTAIAILCIFRKLHCTRNYIHMHLFVSFILKAIAVFVK
DAVLYDVVQESDNCSTGSVGCKAVIVFFQYCIMASFFWLLVEGLYIHALLAVSFFSERKY
FWCYILIGWGGPTVFIMAWSFAKAYFNDVGCWDIIENSDPFWWIIKTPILASILMNFILF
ICIIRILRQKINCPDIGRNESNQYSRLAKSTLLLIPLFGINFIIFAFIPENIKTELRLVF
DLILGSFQGFVVAVLYCFLNGEVQGEIKRKWRRWHLERFLGPDTKYQHPSMGSNGNNFST
QISMLTRCSPKTRRASTCQDETSITV
Download sequence
Identical sequences F1R383
XP_005162755.1.45394 ENSDARP00000116281 ENSDARP00000116281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]