SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000117388 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000117388
Domain Number 1 Region: 339-509
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-62
Family SPRY domain 0.0000154
Further Details:      
 
Domain Number 2 Region: 1-69
Classification Level Classification E-value
Superfamily RING/U-box 6.41e-18
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 3 Region: 120-186
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.83e-16
Family B-box zinc-binding domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000117388   Gene: ENSDARG00000094877   Transcript: ENSDART00000142619
Sequence length 517
Comment pep:novel chromosome:Zv9:7:16997382:17000277:-1 gene:ENSDARG00000094877 transcript:ENSDART00000142619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EELQCSVCLDVFTDPVSTPCGHHFCKSCLNKSWENSQVCRCPLCRERFSDKPSFKINTGL
GEFAQRFKQRLSLRISEVLCDICDGRKMKALKSCLVCQTSYCETHLEPHRRVPNFMKHKL
MEPVINIKHYICQKHERPLELFCRDDQMCVCVFCTDGDHKTHNTVPIQEEIKVKKIQMMK
TQRDMQQMIDERTKKIQDIKHSADLRKESTAREKTSTVELFSDLQRSIERCQAELLEMME
EKQKAAEKQDEELIQELQQEINELKMRNSDLDHLSHTEDHLQLLEVSVSLSAHITGQHSH
SSSPPNIKNWPETSMSTDIIIKTVCPSRLWSQKWIFCPQWTVDVTLDPDTAHQKLILSDD
GKQVSTEDTKQKVPNNLERFDKCICVLGKEGFLTGRLYFEVQMKGKTEWTLGVARESINR
KGKITVGLQDGYWAVGLRNENEYWAYAAPAVRLSVREKPQKVGVFVDYEDGLVSFYDVES
RSHIYSFTGQSFINRLYPYFCPFPNDICKNSASMNIS
Download sequence
Identical sequences ENSDARP00000117388 ENSDARP00000117388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]