SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000117996 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000117996
Domain Number 1 Region: 375-499
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-36
Family SPRY domain 0.0018
Further Details:      
 
Domain Number 2 Region: 7-82
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-21
Family RING finger domain, C3HC4 0.0048
Further Details:      
 
Domain Number 3 Region: 143-208
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000087
Family B-box zinc-binding domain 0.00064
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000117996
Domain Number - Region: 194-301
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0837
Family HBL-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000117996   Gene: ENSDARG00000092745   Transcript: ENSDART00000143980
Sequence length 506
Comment pep:novel chromosome:Zv9:2:60047931:60057000:-1 gene:ENSDARG00000092745 transcript:ENSDART00000143980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESSVSVAHREFSCAVCLDLLKDPVSTACGHNYCMSCITNCWNQEDQKRVYSCPQCRQT
FSPRPALAKNTMLAEMVEKLRKSKLQAAGPAQSPAASGDVECDVCSGAKNRAVKSCLVCL
NSYCHTHFQLHQQLNPGNQHKVTEATHRLKKLICPQHEKPLEIFCRTDHCCICYLCTMDQ
HKNHNTVSAVAERTEQQRRLKNIQSSFQQRLQERQKELEELREAVESHKRSAQAAVDHTE
RIFTQLICWIERSRSELTQMIRDGEKTAVSGAEERLERLEQEINDLRRRNAELEQLSHTE
DHIHFLQSLQSLSVPPGSTDSSSFISSSQLSFNKVTESVSRLRDKLQQFCTEEMKTISSR
VSSISIIPAPEPQTREQFLQYSQQFTLDPNTAHTYLVLSEGNTAVENKGSVQPYPDHPDR
FDCWHQVLCRESVCGRSYWELEWSGVDVLISVSYKSISRKGSGNECLFGLNDQSWSLCCS
ADSFSFYHNNIKTDLPKPSVSSSRRG
Download sequence
Identical sequences B0S651
7955.ENSDARP00000091759 ENSDARP00000117996 ENSDARP00000117996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]