SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000119017 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000119017
Domain Number 1 Region: 175-465
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-79
Family Nuclear receptor ligand-binding domain 0.00000000325
Further Details:      
 
Domain Number 2 Region: 123-203
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.97e-30
Family Nuclear receptor 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000119017   Gene: ENSDARG00000078954   Transcript: ENSDART00000136528
Sequence length 471
Comment pep:putative chromosome:Zv9:19:7871577:7895593:-1 gene:ENSDARG00000078954 transcript:ENSDART00000136528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDSRDSRSPDSSSVSSPPSGQRSPPLAPSAAAMTSLPPITSAVNSPISSMGSPFSVISS
SLGSPCLPGTPSVGYGPISSPQINSTVSMSGLHAVSSSDDVKPPFGLKPLSSHSPGPMVS
QKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLSYTCRDNKDCLVDKRQRNRCQYC
RYQKCLAMGMKREVVQDERQRSVQEERQRNKERDGEVESSSAANEEMPVEKILEAEMAVE
QKTELHADGSSGGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELSLDDQVILLRAGW
NELLIASFSHRSITVKDGILLATGLHVHRNSAHSAGVGAIFDRESAHNAEVGAIFDRVLT
ELVSKMRDMQMDKTELGCLRAIILFNPDAKGLSSPSEVELLREKVYASLEAYCKQRYPDQ
QGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLT
Download sequence
Identical sequences Q7SYN5
ENSDARP00000015784 ENSDARP00000125725 XP_005159467.1.45394 ENSDARP00000119017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]