SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000119720 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000119720
Domain Number 1 Region: 2-86
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-19
Family PDZ domain 0.00014
Further Details:      
 
Domain Number 2 Region: 284-394
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000646
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000119720   Gene: ENSDARG00000094605   Transcript: ENSDART00000143860
Sequence length 416
Comment pep:novel chromosome:Zv9:5:73011305:73095342:1 gene:ENSDARG00000094605 transcript:ENSDART00000143860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQCLTVTVLRGKDGFGFTICSDSPVRIQAVDPGGPADQAGLQQLDTVLQLNGQPVKHWKC
VDLAHAIRNSLSEITVVIWRTGPSVKTKFEGLIHHPSYKSSNYDTPVSPAKCKRAEKAPP
LPPLPAQHRTGHRVVGQNGSEDLATGAGVLWGERRTAVDAKTGTQTLRGTRVKASNGENY
IILSPINPGSQVLGSGDPHRTLTGQMYPAAQTSVPLPPAASAQSAPGLASRTCFLRRSGN
SKSKTQQIYQNTSNFANYQNCTIVRSHVPHANYSTYVKVTPKVLIFPIFVQPVDLCSPTR
TLLITEEMILYESKHFSIKVTVFIYSDLMLVTREDEPGRCNVLQNPLYLRHLQLRDDHCK
DLRFYLIHMTEKCDCLLSLEADSLEQKARVCQCLSENIQKQLRIFHGRQTFRLPQQ
Download sequence
Identical sequences E9QDP3
ENSDARP00000119720 ENSDARP00000119720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]