SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000120287 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000120287
Domain Number 1 Region: 1-461
Classification Level Classification E-value
Superfamily Sema domain 1.26e-126
Family Sema domain 0.0000255
Further Details:      
 
Domain Number 2 Region: 1306-1435,1631-1820
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-52
Family p120GAP domain-like 0.031
Further Details:      
 
Domain Number 3 Region: 912-993
Classification Level Classification E-value
Superfamily E set domains 4.32e-17
Family Other IPT/TIG domains 0.018
Further Details:      
 
Domain Number 4 Region: 995-1098
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000126
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.045
Further Details:      
 
Domain Number 5 Region: 811-907
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000762
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 6 Region: 464-515
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000392
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 760-795
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000549
Family Plexin repeat 0.0033
Further Details:      
 
Domain Number 8 Region: 1105-1179
Classification Level Classification E-value
Superfamily E set domains 0.0000204
Family E-set domains of sugar-utilizing enzymes 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000120287   Gene: ENSDARG00000060372   Transcript: ENSDART00000147998
Sequence length 1850
Comment pep:novel chromosome:Zv9:23:32793166:33106112:-1 gene:ENSDARG00000060372 transcript:ENSDART00000147998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FNHLTVHKTTGALYIGAVNRVYKLSGNLTLLVSHDTGPEDDNKACYPPLIVQPCSEPLIS
TNNINKLLLIDYSQNRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNQTGTMY
GVIVPSQGKDGTLFIGTAVDGKQDYFPTISSRKLPRDPESSAMLDYELHTDFVSSLIKIP
SDTLALVSHFDIYYIYGFASGNFVYFLTVQPETPENSMSSSGPSNDLFYTSRIVRLCKDD
HKFHSYVSLPIGCVRNRVEYRLLQAAYLGKPGRVFAASLNISAQDDVLFAVFSKGQKQYH
HPPDDSALCVFSIRDINARIKERMQSCYQGEGNLELNWLLGKDVPCTKAPVPIDDSFCGL
DINQPLGGSQLVTGHTLYTESRDRMTSVTSYVYNGFCVAFVGTKSGRLKKIRVDGPPQGG
VQYETLSVIKDGNSILRDMAFSLDNSYIYVMSERQVTRVPIESCEQYSTCGECLSSGDPH
CGWCVLHNICSQRDRCERANEPYRFAATLNQCVKATVYPDSIAVSEPSVPLLVKVTDVPD
LSAGITCSFGNLTEVEGRVNGNQILCISPAAKDVPIIPADQDWSGVELRLNSKETGQMLI
STEVKFYNCSVHQLCLSCVTSSFRCHWCKYRNLCTHDPSSCSFQEGRVNASEDCPQLVRS
EEILIPAGEVKPITLKARNLPQPQSGQRGYECVLHIQGVSHRVTALRFNSSSVQCQNSSY
LYEGMRISELPVDFSVVWNGNFIIDNPENIKVHLYKCGAQRDSCGVCLKAERKFQCGWCS
MEGRCTLRQHCPMTNPYTSRWLHLASTNVKCTNPRITEVTPVAGPPEGGTRVTIRGVNLG
LSFSDMVNNVQVAGVQCTPQENGYIIAEQIVCEMDAAPVDSKAGPVHLCVGECKPELQTR
SSQLYSFVMPSVTGLSPSRGPESGGTKVTIMGENLGAGSSVTVLFGNQTCEFYERTMTEI
VCYSAPSLTGVGSVQISVSVDRAQVRDILAFEYIDDPTVQRIEPEWSIASGHTPLVVTGT
NLDVIQEPRIRIKYGGRESVNVCKVLNTTTMSCFAPSLTAEYRPGLDSVKHADEFGFIFN
NVQALLVYNNTNFMYYPNPFFEPLSTNGVLEQKPGSPIILKGKNLVPSAAGGVKLNYTVL
IGETPCSVTVSESQLLCEPPNLTGQYKIMVQVGGLHVSPGSVNILSDSLLTLPAIVSIAA
GGGLLLIIVILVLIAYKRKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELT
SDLDRAGIPYLDYRTYAMRVLFPGIEDHPVLRELEVSGNGQLCVEKALKLFAQLINNKVF
LLTFIRTLEMQRSFSMRDRGNVASLIMTALQGRLEYATDVLKHLLSDLIDKNLESKNHPK
LLLRRTESVAEKMLTNWFAFLLHKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYS
LSEDKLIRQQIDYKTLILNCVNPENENSPEIPVKVLNCDTITQVKEKILDAVYKNMPYSQ
RPKAVDMDLEWRQGRMARVVLQDEDITTKIENDWKRLNTLMHYQVSDRCVVALVPKQTSS
YNIPPTTSISRTSISRYDSTFRYTGSPDSLRSRAPMITPDLESGVKVWHLVKNHEHGDQK
EGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQA
DKHGIHDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKSSITDACLSVVAQTFMDSCST
SEHRLGKDSPSNKLLYAKDIPNYKNWVERYYADISRLPAISDQDMNAYLAEQARLHSSEF
NMLSALNEIYSYISKYSEEITAALDQDETAKKQRLAYKVEQLIAAMSLES
Download sequence
Identical sequences F1QCL2
ENSDARP00000120287 ENSDARP00000120287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]