SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000120982 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000120982
Domain Number 1 Region: 128-375
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.62e-64
Family Nuclear receptor ligand-binding domain 0.0000000172
Further Details:      
 
Domain Number 2 Region: 60-143
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-29
Family Nuclear receptor 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000120982   Gene: ENSDARG00000071565   Transcript: ENSDART00000144193
Sequence length 458
Comment pep:novel chromosome:Zv9:24:24255734:24279331:-1 gene:ENSDARG00000071565 transcript:ENSDART00000144193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFSPTPLPKSLLDMDVANYCEGLDPTYSTLGFENAEVLYCGENMPTEPNISQGENGVSS
NCAICGDKATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFNRQCVVDKDKRNQCRFCRLH
KCFRAGMKKEAVQNERDRISSRRNIQDSHDLPPITALAHAEALSQQITAASPMGPADVSE
KKSATISDVCESMKQQLLVLVEWAKYIPAFGELPLDDQVSLLRAHAGEHLLLGVAKRSMS
YKDLLLLGNGCVIHRNCPEPEIGRVSNRVLDELVLPFQDIQIDDNEYAALKAIVFFDPDA
KSLRDPSKIKAMRYQVQMSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQLQFIK
LFGLAKIDNLLQEMLLGGLTTEQPHLHHNGHPQIPITGQTIVISSIPGPAHPQMASPETP
IPSPTSVQNQEVFKPSGSPALLLPPQTMPNRPSPEPPL
Download sequence
Identical sequences F1QM73
ENSDARP00000120982 NP_001068579.2.45394 ENSDARP00000120982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]