SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000121172 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000121172
Domain Number 1 Region: 12-187
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.41e-41
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 
Domain Number 2 Region: 162-283
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.42e-29
Family Ypt/Rab-GAP domain of gyp1p 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000121172   Gene: ENSDARG00000077871   Transcript: ENSDART00000146996
Sequence length 831
Comment pep:novel chromosome:Zv9:8:42620135:42636879:-1 gene:ENSDARG00000077871 transcript:ENSDART00000146996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVPLAVLRHREAKWLDMLNHWDKWISKRFKKVRLRCQKGIPPSLRGRAWLYLSGGKVKRE
QNVGMFKDLDSMEGDPKWIDVIERDLHRQFPFHEMFVSRGGHGQQDLFRVLKAYTLYRPD
EGYCQAQAPIAAVLLMHMPAEDAFWGLVQICEKYLPGYYSAGLEAIQLDGLILNALLKRV
SPPAYQHLDKHKIEPILYMTEWFMCAFSRTLPWSSVLRVWDMFLCDVKIIFRVGLVLLKC
MLGTREKLKACPGQYETMELLKALEPRYMQEAFLVHQVMEMPISARDVEREHRAQLKRWR
KTHGELSYKSPPRMHGAQAIMSAEPHSRQDLRQKPTIVVEYPLPSDTTSNFARVRRRSTI
RKASSKLDIPNPYALPTDTQPEVETASNNQSSHPPSSLQQSHLTTPAGKSTSTPDPPDSV
IPTPSHPSQPPKPQPSPIFTHISPPSQTAADPRPSHPMEVPHPSKIEPLHNPKDSNNTNN
SAHLKDPPHNSNSNPLLIESRPLPPESRQLPPESRQLPPESRLPSESRQLPLEFKKLPSE
SRQLPLESKQLPSESRQLPLEFKQLPSESRQLPLESKQLPPESWSVPPESKPVLPDLGHL
PPEPGHPPPEPGNLSSEPRNLPPEPRHLPPEPRNFFPEPRHLPPEPRHLPPEPKQLHPES
TQLRGESRALTPESSPLTPESRPLPAEPRQFAPEPIPLPPEPSQLPPELRQLPPQSRQLP
SDSSLFPLPPEFSPLPPEFSPLPPGFSPLLPPPEFSPLPLPLDFSPLPVPPEFSPLPPDF
IPPLPESSPLHPVSSSLLPGDAPVNGDSAAALKVLCLRNSCESVGSEDTYL
Download sequence
Identical sequences ENSDARP00000121172 ENSDARP00000121172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]