SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000121246 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000121246
Domain Number 1 Region: 54-342
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.43e-53
Family Asparaginyl hydroxylase-like 0.058
Further Details:      
 
Domain Number 2 Region: 995-1232
Classification Level Classification E-value
Superfamily RNI-like 1.55e-30
Family Cyclin A/CDK2-associated p19, Skp2 0.09
Further Details:      
 
Domain Number 3 Region: 553-611
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000912
Family PHD domain 0.07
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000121246
Domain Number - Region: 728-760
Classification Level Classification E-value
Superfamily ARM repeat 0.00184
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000121246   Gene: ENSDARG00000059653   Transcript: ENSDART00000147357
Sequence length 1242
Comment pep:known chromosome:Zv9:1:45294192:45325450:1 gene:ENSDARG00000059653 transcript:ENSDART00000147357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVMSAGDATSRSKRSGTRRRYQDDGISDDEIDGRRTFDLEEKLHSSFFSSDRVKRMEGK
DFSYEYVQRHGLRDPIIFEKPEGLGIKMPDPDFTVNDVKLFVGSRRIVDVMDVATQKGTE
MSMAQWRRYYETPPSQREKLYNVISLEFSHTKLETLVKRPSTVDMIDWVDNMWPRHLKER
QRDSTNSIMEMQYPKVQKYCLMSVQGCYTDFHIDFGGTSVWYHIHKGCKVFWLIPPTPQN
LELYENWVLSGKQGDIFLGDRATDCQRIELKQGYTFIIPSGWIHAVYTPVDTLVFGGNFL
HSFNVPMQLDISGIEDRTRVPVKFRYPFFFEMCWYVLERYLYSLTNKSHLIPEFQKHSLG
IGLKRENSEVLNGHAKEERDEMDAPSPPSAPGLKTHLTAFELEGLWRLVGKLESLPSNKK
CVPSGIHNAAALLLDIRALLKEHANDIPKLSYTGRPIVRWPKRPPWYQPPPPPPPVMRPK
LATTPIVPRPVKPASNMSVLRRRRVRCKRCEACLRTECGDCNFCRDMKKFGGPGKLKQTC
VLRQCLAPGLPLSAVCELCGEGNQETSEELMECSNCAQIAHPSCLKTSGEGVVNKDLPSC
WECPKCVLGKDTDSEIKLDGGKSHKRKSSSLDPRVAKIYRRHGMEHDDDSGSDDDGDGGR
MSSVRSSVSSSRRGYGASRRGVWRGSSQRGPRGGGSLSSSSLKMRRGLGARGERGGRVRL
RGGSQMRRRRYETDDDDDDDDDDDDDDDDDDDEDEDDEDDSEEDRHVSRSEKEHRSRRRR
RRGDDYDDDEDEDDDDEEDSEEQDYEGEDDEMEDLDDGGDEDDEDGENQSDSDPDPPVLL
VSDLNDDLLNDSYLTVTLHRPPKAKRDPGSIVPKLEAAMSPRTGGSSGFMQRKTLPKARP
KTSSSTPAGNGLSQAKSGRPTRRSSNQDGRERDTASPSSMSSRSSVSPPPPPPAVTSSSP
SLLSHPSFRDAGNELGCEKDIWVSVFRYLDRTDLAVCMRVCKAWFKWCCDKRLWTRIDLS
RCRALSPQAVTAIIKLQPVTLDLSWTPVSKKQLAWLIHHLPSLKDLIMSGCSSLCVSALS
SPSCPSLRTLDLCWAVGVKDSQIKDLIVQPGSESRSRLRSLVSLRLSGLELSDAVIKTMV
RHMPSLRQLDLSYCQGLTDQSINLLTATGCNTRNTLRQLNLSGCNKLSDGCLSYMKRLSA
LALLDLRGCKNVTRHGCENFISDLSYCTVFCLTEDKLIQRVS
Download sequence
Identical sequences B8A652
ENSDARP00000121246 ENSDARP00000121246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]