SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000121690 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000121690
Domain Number 1 Region: 11-202
Classification Level Classification E-value
Superfamily Kelch motif 4.45e-28
Family Kelch motif 0.0062
Further Details:      
 
Domain Number 2 Region: 166-395
Classification Level Classification E-value
Superfamily Kelch motif 2.62e-27
Family Kelch motif 0.023
Further Details:      
 
Domain Number 3 Region: 1780-1958
Classification Level Classification E-value
Superfamily Fibronectin type III 4.18e-19
Family Fibronectin type III 0.0000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000121690   Gene: ENSDARG00000012519   Transcript: ENSDART00000132536
Sequence length 1993
Comment pep:novel chromosome:Zv9:8:8043459:8104447:-1 gene:ENSDARG00000012519 transcript:ENSDART00000132536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSGTSVLQPRWKRVLGWSGPVPRPRHGHRAVAIKELMVVFGGGNEGIVDELHVYNTAT
NQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKPK
APKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYTLELRPGSNVAG
WDIPITYGVLPPPRESHTAVVYTEKTSKKSRLIIYGGMSGCRLGDLWTLDIDTLTWNKPA
ISGAAPLPRSLHSATTITNKMFVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLDSMSW
ETILMDTLEDNIPRARAGHCSVAINNRLYVWSGRDGYRKAWNNQVCCKDLWYLETDRPQP
PSRVQLVRANTNSLEVSWGAVPTADTYLLQLQKYDIPAATAATSPTVNPMPSVPVNSPKS
PVPAAAAPAAQSMPLSGVTLVPQVPSPTTAMPTSPLAASPRGPAILKVAAPHSTPGTSVV
TVRQATPGAKSPVTVTSLPAGVRMVVPAQSTQGTPIGSSPQMSGMAALAAAAAATQKIPP
SSATTVLNVPAGATLVKTVAVTPGSTTLPATVKVASPVMVTNPATRMLKTAAAQVGTSAI
STPNTPTRPIITVHKSGTVTVAQQAQVVTTMVGGVTKTITLVKSPITMGGSGALYSQLSS
LGKVMSVVQTKPVQTSAVTGQAGSSPVTLIQTKTPLPAGTILKLVTSADGKPTTIITTSQ
AGGTGTKPTILGISSVSPTTTNKPGTTIIKTIPMSALQGATGVTSSAGIKSPITIITTKV
VTPGTGTPGKIITAVPKLTGAGQQGVTQVVLKGAPGQPGTILRTVPMGGVRLVSPGTVSA
DKPTVTTLVVKGTTGVTTLGTVTGTVSTSVAGANVANASLATPVTTLASIATLSSQVINP
TAITVSAAQTNLATATIQSASQPTQVTLITTPSGAEAQPGQDLPVSFLASPTSEQPSTTG
ADAGDSAGDGATTVTLVCSNPPCETHETGTTNTATTASAKIGTEQICSNPPCETHVTGTT
NTSTTASANMGRAQQVCTNPPSETHDTGTTNTATTASCNMGSTEMGTVNSKPGSSSPPAS
SSSEPSTPVSESGAEAGVMRPENLRTGTTYTSTTARSNMGSDQTGTVQSSNKSQAAISST
MMPVSSSESPGDTDTSDVSGSVCSNPPCETRETGTTSTPTQSSADMESGQSGSVQRVCSN
PPCETHETGTTNTSTQASSSMAAGQSGTAQRVCSNPPCETHETGTTNTPTQASSSLGAGQ
SGTVQRVCSNPPCETHETGTTNTPTQASSSLGAGQSGTVQRVCSNPPCETHETGTTNTQT
QASSTLGAGQSGAVQRVCSNPRETHETGTTNTPTQASSGIGAGQNGTVQMVCSNPPCETH
ETGTTNTATTATSNLETGEGAAQQAGDGQSESATSTEPTSSTEPANPATQSRAITTVTQA
TPTPGPSVPEISSMAGSAVVSETPGEAEAMEQASAEAVAAGEEPMQTESQGELSEEGAVR
VVAIDESAAGDGSTVLQVHVAMEAQPGQGDQAEQMEAGVEAAEAMSLAAQDSEALALPQE
LMSAEGQQTTLMVTGLTPEELAVTAAAEAAAQAAATEEAQALAIQAVLQAAQQAVLSGEG
DAGHDGQQATTIPIVLTQQELAALVQQQQQLQEAQAAAAQQLSAEAAAAALPTEGLAPAD
SLNDPASESNGHEMPTAVTGAVVRLLPRTSAETLAPSSTFAPSQPLVVASPAKMQAATAL
AEVANGIESAAGKQEAPPVVVKPPVKKENQWFDVGIVKVTNMVVTHYYVPADDSAVTDDD
SGAIPDYSRMKKIELSPGTAYKFRVAGINACGRGTFSEVSAFKTCLPGFPGAPCAIKISK
SPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQTVEAKASAPAQLAFMRVYCGPNPSCLVQ
SSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWLQETSKDGSAAKPAAKRPVSSPD
MKGAGPKKARSDQ
Download sequence
Identical sequences A8WIP5
ENSDARP00000121690 7955.ENSDARP00000019381 NP_001122009.1.45394 XP_021333957.1.45394 ENSDARP00000121690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]