SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000122131 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000122131
Domain Number 1 Region: 375-456
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-21
Family SPRY domain 0.0028
Further Details:      
 
Domain Number 2 Region: 12-82
Classification Level Classification E-value
Superfamily RING/U-box 1.46e-17
Family RING finger domain, C3HC4 0.0068
Further Details:      
 
Domain Number 3 Region: 143-208
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000153
Family B-box zinc-binding domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000122131   Gene: ENSDARG00000079614   Transcript: ENSDART00000137134
Sequence length 456
Comment pep:novel chromosome:Zv9:2:60193412:60202382:-1 gene:ENSDARG00000079614 transcript:ENSDART00000137134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESSVSLAHCKFSCSECLDLLKDPVSIPCGHSYCMSCITDCWNQEDQKRVYSCPQCRQT
FSPRPALAKNTMLAEVLEKLQKSKLQAAGPAQSPAASGDVECDVCTGAKNRAVKSCLVCL
NSYCHTHFQLHQELNPGNQHKVIEATHRLKEMICQQHKKLLEIFCRTDHCCICSLCVLDG
HKNHDTVSAAAQRTKKQCRLKKTQSRFQQRLQERQKELEELREAVESHKHSAQAAVDHTE
RIFTQLICWIERSRSELTQMIRDGEKTAVSGAEERLERLEQEINDLRRRNAELEQLSHTE
DHIHFLQSFQSLSVPPGSTDSSSFFISSQLSFNKVTESVSRLSDKLQQFCTEEMKTISDK
VRFISIIPAPEPQTREQFLQYSQQFTLDPNTVNKKLVLSEGNTAVEINGSDQPYPDHPDR
FDGFSQVLCKESVCGRSYWELECSSASVYLSVSYKS
Download sequence
Identical sequences B0S6J2
ENSDARP00000122131 ENSDARP00000122131 7955.ENSDARP00000088571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]