SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000122775 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000122775
Domain Number 1 Region: 496-593
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.68e-19
Family Tudor domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000122775   Gene: ENSDARG00000071450   Transcript: ENSDART00000134798
Sequence length 905
Comment pep:known chromosome:Zv9:22:17483850:17502695:1 gene:ENSDARG00000071450 transcript:ENSDART00000134798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQDQLLAGLKKDVRSLLVSSKHGLTPEHLRRDYQSMLGFPMPLRLLGFRNVLDMVKEMP
EVVRLEYQLDGNIILKAIGDDTTKGIEELVSKQRDHKPKPNNRKGKPGYFNISYPRLQPV
ILPRRGQAKPALPAHLRSQLKQLLSHGPVRLSELESRYVAQFGKPLNVTQYGFFSISEML
SAAMDFIIMQQSRTGSQLLLRSAVTPQNQPENLMRRFSMQSTSPKQRLAGFSPKASSLPE
RRPEVSLDPSSVSKPEPVKEEQSFEETVFKLEEELRQQILEKGTAGTVSQELKEKLRKVV
AENGNGISIHNLPTEYQRMHGEELPVSQCGFLSVTEMVGALSDTLAIQRGTDESESHWMV
VEFKPIDTQPCEPELSPGDGTTSSPTGELQNPSSRAFYFSCPESAWEHEETEPLTDSQES
DAELRVANKTIHQMVNLFPELMVSRVSAVPLDAVRCQKLKPPVHRKERELLPVLVEQTES
PSYFYIRFSQNKEARALENMMIEMRSCYSYPDVAERYRLPDAYVRPGQVCCVAPRDMWFY
RVVIHEVFSETEVKVYYVDYGDITKVERHSLRFLKACYADLPAQAVPAMLAGVRPITNIW
PASAVSCFQRLCCERTLVAGVHSYQEDFLLLFLCDTNTEEDVYVHLALIQEGHAQPCSAA
YGLVSEKFNPVTSYFGYDQLEDVKESLSPFSCSPDAEIDSQGNDSPSSCRTASNSESGET
NLASIDVDPNLDLPPLEVINVPDVNTAAKSENVNPFEALVRKDPLFNSEWDQGWTAEDKT
DETKFELDVSTEQSKPETVYTPSPVQAAVGKQQLCASPVEPKVNATTCVNPHNPVPIQIN
CSYPVLPGVPVYPVKPPISQFMMQLLGNPVYQGPGPNTAFQHLTSPLALRPAARMSAGGQ
ILHWS
Download sequence
Identical sequences Q1L981
ENSDARP00000122775 NP_001038315.1.45394 ENSDARP00000122775 7955.ENSDARP00000096428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]