SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000123235 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000123235
Domain Number 1 Region: 600-913
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.27e-90
Family Protein kinases, catalytic subunit 0.00000005
Further Details:      
 
Domain Number 2 Region: 36-116
Classification Level Classification E-value
Superfamily HR1 repeat 2.49e-21
Family HR1 repeat 0.00015
Further Details:      
 
Domain Number 3 Region: 212-280
Classification Level Classification E-value
Superfamily HR1 repeat 9.16e-18
Family HR1 repeat 0.0042
Further Details:      
 
Domain Number 4 Region: 140-206
Classification Level Classification E-value
Superfamily HR1 repeat 2.35e-17
Family HR1 repeat 0.00019
Further Details:      
 
Domain Number 5 Region: 383-473
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000512
Family PLC-like (P variant) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000123235   Gene: ENSDARG00000060184   Transcript: ENSDART00000132555
Sequence length 930
Comment pep:novel chromosome:Zv9:1:46254579:46306860:1 gene:ENSDARG00000060184 transcript:ENSDART00000132555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEEGRNTSLTEQHDDDTITQTETPSDPGGLSGLERLGLDHSSDYSDSSVQQRLDKERE
RIRREIRKELKIKEGAENLRRATTDKRNAQQVDSQLRCSNRRLDSLHAELQELDAHIVVK
GTDDTHDDAPQSPGAESRSSAHKERIAALERQLNIELKVKQGAENMIPIYTNGSTKQMLQ
DSKTKIDIIRMQIRKAVQAYEHNDDTQGKPDPCGMELRIEELRHHYRVEHAVAEGAKNVL
RLLGASKAQCRLSESSQRLDLLRDSLDRRLAELPEDHPKASVIKEELVLASSPAFSSQHS
APYLHNQYSTLSKPSPLTGRLQVTLLGCMGLLEVVPGRSRGSQVVLPCYSPGEGRSFMRS
GKGLYSRSGSVSGKTPLKTDELSSDVSAVLKLDNTVVCQTAWKMVGEQGWDQTFIIELER
SREMEIAVYWRDYRSLCALKFLKLEDFLDNQKHKVQLELEPQGLLLAEVTFFNPVIERVP
RLKRQKNVFSKQQGKAFLRARQMNVDIGTFVRLLRNAIPTVNNTGTYSPNAHTLQTGEIS
VEKLSLDFDSPMKVDIRREVTDISTPERQPSTEPLSAPDVTTPIRTHSLSSKQKKTSLSL
QDFRLIAVLGRGHFGKVLLAEYKKSGSMYAIKALKKGDIVARDEVESLMCEKRIFEAVNG
AQHPFLVNLFACFQTPEHVCFVMEYTAGGDLMMHIHADVFTEPRAVFYSACVVLGLQFLH
DNKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGFGDRTSTFCGTPEFLAPEVLTDTSY
TRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSAEAIGIMRRLLRR
NPERRLGSSEKDAEDVKKQPFFRNMDWEALLLRKLPPPFIPSIGGKEDVSNFDEEFTTEA
PTLTPPREPRVLSRKDQDSFRDFDYVSDLC
Download sequence
Identical sequences F6NV75
ENSDARP00000123235 ENSDARP00000123235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]