SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000126118 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000126118
Domain Number 1 Region: 344-529
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-66
Family SPRY domain 0.00000463
Further Details:      
 
Domain Number 2 Region: 5-78
Classification Level Classification E-value
Superfamily RING/U-box 1.72e-20
Family RING finger domain, C3HC4 0.0056
Further Details:      
 
Domain Number 3 Region: 127-193
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.21e-17
Family B-box zinc-binding domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000126118   Gene: ENSDARG00000058963   Transcript: ENSDART00000013850
Sequence length 533
Comment pep:known chromosome:Zv9:19:2866609:2870984:-1 gene:ENSDARG00000058963 transcript:ENSDART00000013850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSSNPLSEELQCSVCLEVFTDPVSTPCGHNFCRSCLNKCWNNSETCSCPYCKETFTQRPD
LKINTTLREISEHYKEKKPEEKAEVVCDVCEDRKLKALKSCLVCQISYCQTHLEPHLRVA
GLKKHKLMDPVRNLEDYICQKHDRPLELFCRDDQMCVCLCCIVTDHKNHNTVPVQEESEE
KKTELMKTQTDVQQMIQDRIKKIQDIKHSAGVRKINSEKEKAAHVEIFTDLIRSIERCQT
ELLEMMEEQQKAAEKLEEELIEELEQEITELKMRNTELEQLSHTEDHLHLLQMCSSLQCR
PADTRTWPEISVKTCDSLEALRKALDQLKDTVEKKLSQSMSPELKWMQQYAVDVTLDPDT
ANPYLILSEDGKQVTCGDIRQKLPDKPQRFDIYLDVLGKEGFSSGRFYYEVQVKGKTDWT
LGVVRESVDRKGEVIHSPSDGFWTVILGDGNEYEANADSPVSLSVKVKLQRVGVFVDYEE
GLVSFYDVESSSHIYSYTGQTFTDKLYPYFSPEINDNGKNSTSLIITPVSVNK
Download sequence
Identical sequences ENSDARP00000126118 ENSDARP00000126118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]