SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000126225 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000126225
Domain Number 1 Region: 6-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.63e-77
Family BAR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 397-574
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.24e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.00000199
Further Details:      
 
Domain Number 3 Region: 263-370
Classification Level Classification E-value
Superfamily PH domain-like 4.79e-16
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 4 Region: 824-879
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000656
Family SH3-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000126225   Gene: ENSDARG00000056619   Transcript: ENSDART00000151342
Sequence length 880
Comment pep:novel chromosome:Zv9:21:21853927:21911046:1 gene:ENSDARG00000056619 transcript:ENSDART00000151342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPALEFSDSFLDSPDFRERLKCHEIELDRTNKFIKELIKDGNMLISALKSLSAAVQKF
SQSLQDFQFECIGDAETDDEINIAQSFKEFSQLLNTVEEERRRLIQNADDVLITPLEKFR
KEQIGAAKEGKKKFDKETEKYYTVLEKHLSLSSRKKESLLQEADTQISKERQVFYDASLE
YVFKIQEVQERKKFEFVEPLLAFLQGLFTFYHEGYELAHEFEPYKQQLQFNLQNTRNNFE
STRQEVENLMRRIRSAEQDFKAPGQWTMEGFLYVQEKRPLGCTWTRHYCTYEKGTKMFTM
SNSELKTGGKQNGLIMSPPEMFKLKSCIRRRTDSIDKRFCFDIEVVERHGIITLQSLSES
NRRLWMEAMDGKEPIYTLPALLSKKEETFLNEAGFNFVRKCIESVEARGINTLGLYRIGG
VNSKVQRLMTSVFAAKAPADLDLDPDTWDNKTITSGLKNYLRCLAEPLMTYRLHKDFIMA
VKSDDQNYRVCAVHALVYKLPDKNKEMLNLLIKHLHVVSTHSQKNLMTVSNLGVIFGPTL
MRSQEETVAAMMNIKFQNIVVEILIENYDKIFHQAPDPNVPLPHPQSHSQSRGGARRSKA
ICLSSGSRKSRGLYPPALCLADADSDTFSSSPSSTPMGSMESLSSHSSEQNSCSKTGSPS
RNKHKASGSLCWTTPSPSTNGPKSPACTTSPDSSSKEDANKTDGEWEEALSTSPGDRSSP
ASELLHRTLGETAEDQRSLSSCSSLTSLHISEGFRSCHGSIQSLVSRSQRDSLKSLHMPD
LPPKDGMRFRDDSSASNGYQRPGSVVACRAAIFECPVISQPTTGRDAKALYSCQAEHSHE
LSFPQGAHFSNVYPSVEPGWLQATFDGKTGLIPENYVEYL
Download sequence
Identical sequences I3ITG1
ENSDARP00000126225 ENSDARP00000126225 NP_001189372.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]