SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000044 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000044
Domain Number 1 Region: 65-160
Classification Level Classification E-value
Superfamily F-box domain 1.11e-17
Family F-box domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000044   Gene: ENSCAFG00000000029   Transcript: ENSCAFT00000000047
Sequence length 509
Comment pep:known_by_projection chromosome:CanFam3.1:1:5182244:5231417:1 gene:ENSCAFG00000000029 transcript:ENSCAFT00000000047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGRGRLLLQHWRGLLALHWPPGGVGAAPGLAGEFNCRKRPGTSYAGTATLKQCARRGR
HYKQPSADHPASLESMPSEILLKIFSYLDAVTLLCTGCVNRRFYHLANDNFIWIRIYSTA
FSPKISNWQVNSAEKTTVSMNLLSVEDKEAGYWKKEYIAKQRASVKAALARVLKPVNPYT
GLPVKTKEALRISGLGWVIILKEKNGKEYIMQHIDLLINDSSVTIIWYGRNWPQLATLST
LDLCGVTPVFRDRSKPPSKNGPRWLSLIAKYNLSNLTESTMIGWDRLIRIFCLHPGLLVG
LWKREEELAFVMANLHFHHLVEKSTLGSATVPYELPPHTPLLDDNPEYGLHGYQLHVDMH
SGGVFYLCGTFRNLFTKKGSIENGYVKLVVIRFKNNTEHLPLIGRKVSSAYCIGIYNTCI
YNCSIMDITLLDEYGKPFWCLSSPVCMRSSVPSDGPNFLGQTYCVDYVDSEGKVHVELVW
IKETEEYFIVSLVLYLKIAKINHWFGTAY
Download sequence
Identical sequences F1PJK0
ENSCAFP00000000044 ENSCAFP00000000044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]