SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000062 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000062
Domain Number 1 Region: 2-374
Classification Level Classification E-value
Superfamily Serpins 4.58e-134
Family Serpins 0.00000000564
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000062   Gene: ENSCAFG00000000058   Transcript: ENSCAFT00000000078
Sequence length 374
Comment pep:known_by_projection chromosome:CanFam3.1:1:13213440:13223912:-1 gene:ENSCAFG00000000058 transcript:ENSCAFT00000000078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDLYEANGSFAINLLKMLGREDSSRNVFCSPLSISSALAMVFMGAKGNTAAQMSQALCL
SRDGDIHQGFRSLLAEVNKSGTQYLLRTANRLFGEETCDFLPAYRESCQKFYQAELEELS
FAKDTEECREHINHWVTEKTEGKISEILGAGTVDALTKLVLVNAIYFKGKWHEQFDRKNT
RGMPFKINQERKTVQMMFKQAKFKMGYVDDVHTQILELPYAGEELSMVILLPDDNTDLAE
VEKALTYEKFRAWTDPENMTKNKVQVFLPRLKLEESYDLESFLRSVGMIDAFEEAKADFS
GMSAKKNVPVSKVAHKCFVEVNEEGTEAAAATAVVRNARCSRAEPRFCADHPFLFFIIHR
HTNSILFCGRFCSP
Download sequence
Identical sequences F1PIV3
XP_848751.1.84170 ENSCAFP00000000062 ENSCAFP00000000062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]