SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000063 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000063
Domain Number 1 Region: 1-380
Classification Level Classification E-value
Superfamily Serpins 4.71e-118
Family Serpins 0.0000000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000063   Gene: ENSCAFG00000023436   Transcript: ENSCAFT00000000079
Sequence length 380
Comment pep:known_by_projection chromosome:CanFam3.1:1:13335903:13358107:-1 gene:ENSCAFG00000023436 transcript:ENSCAFT00000000079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLAAANAEFCFNLFREMDNNQGSENVFFSSLSIFTALALVRLGARGDCVSQIDKMLHF
NTASGWGSSSNTQPGLQSQLKRVLSDINTSHRYYELSIVNGLFAEKVFDFHKDYIECAEK
LYNAKVERVDFTNDVEDTRYKINKWVENETHGKIRNVFQEDGISSSAVMVLVNAVYFKGK
WELAFSKNETLNCHFKSPKCPGKAVSMMHQERKFNLSVIRDPPMQVLELKYHGGISMYIM
LPENDLSQIENRLTFQNLMEWTNPRKMSSQYVEVFLPQFKIEKNYEIKHHLRALGLKDIF
DESRADLSGIAAGGRLYVSKMVHKSYIEVTEEGTEATAATGSNIVEKQLPESRVFRADHP
FLFIIRKNDIILFSGKVSCP
Download sequence
Identical sequences E2R082
ENSCAFP00000000063 XP_005615395.1.84170 XP_541072.3.84170 9615.ENSCAFP00000000063 ENSCAFP00000000063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]