SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000064 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000064
Domain Number 1 Region: 1-397
Classification Level Classification E-value
Superfamily Serpins 1.31e-132
Family Serpins 0.00000000927
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000064   Gene: ENSCAFG00000023582   Transcript: ENSCAFT00000000080
Sequence length 397
Comment pep:known_by_projection chromosome:CanFam3.1:1:13233353:13256253:-1 gene:ENSCAFG00000023582 transcript:ENSCAFT00000000080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLAKSINQFALDFSKKLAESAEGKNIFFSPWGISTSLAMVYLGTGSTTAAQMAQVLHF
SRDKDLKSCPESEKKRKMEFGLGKVEEIHSHFQTLISEINNPSTSYVLKTANRLYGEKTY
PFHTKYLEDMKAYFGAEPQSVNFVGASGQIRKEINSWVESQTEGKIPNLLPDDAVDSATR
MVLVNALYFKGIWEHQFSVQDTTEKPFRINKSTSKPVLMMSMKEKLQIFHIEKPQAIGLQ
LYYDSHDLSLLVLLPEDVDGLDQLERAITYEKLSEWTSADMMELYEVELHLPKFRLEETY
DLKSSLRSMGMSDAFNQGKADFSGMSMEGNLFLSNVFHKSFIEINEQGTEAAAGSGSEVS
IRSRLPPIEFNANHPFLFFIRHNKTASILFYGRFCSP
Download sequence
Identical sequences E2R081
9615.ENSCAFP00000000064 ENSCAFP00000000064 ENSCAFP00000000064 XP_541071.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]