SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000068 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000068
Domain Number 1 Region: 1-392
Classification Level Classification E-value
Superfamily Serpins 1.31e-131
Family Serpins 0.0000000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000068   Gene: ENSCAFG00000023362   Transcript: ENSCAFT00000000084
Sequence length 397
Comment pep:known_by_projection chromosome:CanFam3.1:1:13409955:13481753:-1 gene:ENSCAFG00000023362 transcript:ENSCAFT00000000084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTLSTANTEFCLDVFKELNSNNVGDNIFFSPLSLLYALSMVLLGARGNSAEQMEKVLHF
SHMTQSLKPEFKDSAKCSQAGRIHSEFGVLFSQINQPDSNYTLSMANRLYGTKAMVFHQQ
YLTCSEKLYQAMPQTVDFEQSPEETRKTINAWVESKTNGKVTNLFGKGTIDPSCVMVLVN
AIYFKGQWQNKFQERETVKMPFQLNEGKSIIVEMMYQTGTYKLAFIKEPQMQVLELPYVN
NKLSMIILLPAGTASLEQIEKELNTKTFNEWTSSANMVEREVEVHIPRFKLEIKYELKSL
LNSLGMTDVFNEITADLSGISPVDGLYLSKVIHQSYVDVNEEGTEAAAATGDSFVVKRLP
IRARFLANHPFLFFIRLSHTNTILFCGKLASPLNKQA
Download sequence
Identical sequences E2R078
XP_005615396.1.84170 XP_541073.2.84170 ENSCAFP00000000068 ENSCAFP00000000068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]