SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000071 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000071
Domain Number 1 Region: 31-433
Classification Level Classification E-value
Superfamily Serpins 1.96e-124
Family Serpins 0.0000000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000071   Gene: ENSCAFG00000023050   Transcript: ENSCAFT00000000087
Sequence length 433
Comment pep:known_by_projection chromosome:CanFam3.1:1:13491208:13505678:-1 gene:ENSCAFG00000023050 transcript:ENSCAFT00000000087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRERQRECYKFKISTTHVTHASFGSSLKPPLPLQKPDLAGIFMDSLGAAYTHFGFNLFQ
KLNKINDGNIFFSPVGISAAIGMLIPGAREATAMQLQRMLFSEKDTGSSRNKTEEREIDK
TEEIHHQFQEFLNEIGKPTNDYELKIANRLFGEKTYLFLQKYLDYVEKYYHASLEPVDFV
NAADESRKKINSWVESQTNEKIKDLFPDDSLNSLTKLVLVNIVYFKGQWDREFKKENTKE
EEFWLNKSTSKSVPMMTQCHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLPNDIDGLEKI
LDQITPEKLVEWTNPGYMEERNVTLHLPRFEVEDGYNLEAVLAAMGLGDAFSVCGADSPG
APSQSRLQAQKFLHRSFVVVTEEGTESTAATSVGFALSSALSCEHFHCNHPFLFFIRHHE
SNSILFFGRFSSP
Download sequence
Identical sequences E2R066
ENSCAFP00000000071 XP_005615399.1.84170 ENSCAFP00000000071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]