SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000072 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000072
Domain Number 1 Region: 1-64,106-425
Classification Level Classification E-value
Superfamily Serpins 8.64e-128
Family Serpins 0.0000000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000072   Gene: ENSCAFG00000023015   Transcript: ENSCAFT00000000088
Sequence length 425
Comment pep:known_by_projection chromosome:CanFam3.1:1:13518850:13528354:-1 gene:ENSCAFG00000023015 transcript:ENSCAFT00000000088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLVAANTKFCFDLFQEISKDDHHKNIFFCPLSLSAALGMVRLGARSDSAEQIDQVLHF
SEFSQNESKEPDPCLKSKKQEVLADSSLEAQEEIKGSLQDQEESSSDESGLLSCYFGHLL
SKIDRIRVDYTLSIANRLYGEQGFPICPEYLDGVIQFYHTTIESIDFRKETEKSRQQINF
WVESQSQGKIKELFDKDAIDSTTVLVLVNAVYFKAKWEKYFDSKNTVDAPFSLNENEKKT
VKMMHQKGLFRIGFIEELKAQILEMRYIKGALSMFVLLPPYSADNVKGLEELEKNITHEK
IVAWSSSENMSEETVEVSFPQFTLEDSYDLNSILQDMGITDVFEEGKADLTGISPSPNLY
LSKVVHKTFVEVDEDGTQAVAASGAVGMERSLSSGVTFTVDHPFLFFIRHNKTKTILFYG
RVCSP
Download sequence
Identical sequences E2R065
ENSCAFP00000000072 9615.ENSCAFP00000000072 ENSCAFP00000000072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]