SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000091 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000091
Domain Number 1 Region: 2-66,100-415
Classification Level Classification E-value
Superfamily Serpins 2.49e-136
Family Serpins 0.0000000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000091   Gene: ENSCAFG00000000062   Transcript: ENSCAFT00000000107
Sequence length 415
Comment pep:novel chromosome:CanFam3.1:1:13465449:13472089:1 gene:ENSCAFG00000000062 transcript:ENSCAFT00000000107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSLSAANTRFAFDLFQQFKTSKKGDNIFFSPLSISSALAMTYLGAKENTALEIGKVLHF
NEATESTTEFQINCEKSVFREILRRLSPEGRSALCQKRDTNVEKMENVHHQFQKLLTELK
KPTDAYELNMANKFYGEKKYQFLQEYMDNIKKFYLASVESVDFNNAAEESRKKINSWVES
QTNEKIKDMFPKDSLNHTILVLVNAVYFKGQWDTKFDTKNTVEKEFWLDKDTSKPVQMMR
QSNVFNFTSLEDLQAKILEIPYKGKDLSMMLLLPHEVDGLQKLEDQLTAENLIEWTSSQN
MSNGQVDLYLPRFKVEESYELKATLKALGMVDAFNTKRANFSGMTGRQDLVVSKVRHKSF
VEVTEEGTEAAASTDVEVIAKSAPIYPFHCDHPFLFFIKHNKTNSILFLGRVSSP
Download sequence
Identical sequences E2R033
ENSCAFP00000000091 ENSCAFP00000000091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]