SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000180 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000180
Domain Number 1 Region: 317-568
Classification Level Classification E-value
Superfamily p53-like transcription factors 8.04e-87
Family STAT DNA-binding domain 0.000000702
Further Details:      
 
Domain Number 2 Region: 140-314
Classification Level Classification E-value
Superfamily STAT 2.55e-42
Family STAT 0.00017
Further Details:      
 
Domain Number 3 Region: 569-685
Classification Level Classification E-value
Superfamily SH2 domain 8.89e-38
Family SH2 domain 0.0000342
Further Details:      
 
Domain Number 4 Region: 1-124
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 4.18e-31
Family Transcription factor STAT-4 N-domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000180   Gene: ENSCAFG00000000121   Transcript: ENSCAFT00000000201
Sequence length 856
Comment pep:known chromosome:CanFam3.1:10:642718:658546:-1 gene:ENSCAFG00000000121 transcript:ENSCAFT00000000201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQWEMLQNLDNPFQDQLHQLYSDSLLPVDIRQHLAVWIEDQNWQEAALGNDDSKVNMLF
FHFLDQLKYECGRCGQDPECFLLQHNLRKFYRDIQALPQGPTQLAEMIFNLLLEEKRILT
QAQRAQLEQGDPALKTPVESQQDEIESRILELKAMMERLVKSISQLKDQQDVFCFRYKIQ
AQVKKFSLDPHQMRQHQLLQETLNELDRRRKEVLDATKALLGRLTTLIELLLPKLEEWKA
QQQKACIGAPQEGGLEQLEKWFTAGAKLLFHLRQLLEELKGLSHLVSYQDDPLTAGVNLR
KAQVLELLQRLLHRGFVVETQPCMPQTPHRPLILKTGSKFTIRTRLLVRLQEGNESLTAE
VSIDKNPQSQGNSFRKFNILTSNQKTLTPEKGQSQGLIWDFGYLTLVEQRSGGPGKGCNK
GMLGVTEELHIISITVKYTYQGLKEELKTDTLPVVIISNMNQVSIAWASVLWFNLLSSNP
QNQQFFSSPPMAPWSLLGPALSWQFSSYVGRGLDPDQLSMLRNKLFGQNSRTEGALLSWA
DFTKRESPPGKLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSKERRLLKKTISGTFL
LRFSETSEGGITCSWVEHQDDDKVLINSLQPFTKEVLQSLPLTKIIRHYQLLTEENIPEN
PLCFLYPRIPRDEAFGCYYQEKVNLEERRKYLKHRLIVVSNRQVDELQQPLELKPEPEAE
SLELETGLDPLLQQEPCLELEPLLAAGLDLGPPLEPMLEPTLDMVPQGVSEPDLGPELRL
EPLPDPASQAVPEPDLPHDLRHLNTEEMEIFRNSMKIEEIMPNGDPLLAGQNIMDEAYVF
HSSHFYTDGPLIPSDY
Download sequence
Identical sequences F6XAW1
ENSCAFP00000000180 ENSCAFP00000000180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]