SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000244 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000244
Domain Number 1 Region: 268-528
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.16e-79
Family STAT DNA-binding domain 0.0004
Further Details:      
 
Domain Number 2 Region: 529-648
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-35
Family SH2 domain 0.00024
Further Details:      
 
Domain Number 3 Region: 112-273
Classification Level Classification E-value
Superfamily STAT 4.12e-27
Family STAT 0.0032
Further Details:      
 
Domain Number 4 Region: 1-115
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 6.41e-27
Family Transcription factor STAT-4 N-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000244   Gene: ENSCAFG00000000163   Transcript: ENSCAFT00000000269
Sequence length 844
Comment pep:known_by_projection chromosome:CanFam3.1:10:1233691:1246052:-1 gene:ENSCAFG00000000163 transcript:ENSCAFT00000000269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWSLVSKMPPEKLQRLYVDFPQHLRHLLSDWLENQPWEFLVGSDTFCCNMASALLSAT
VQRLQASAGKQGEGSTILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMP
FHWKQEELKFNTALQRLQHRVGETRLLREALQPGAEAGQVSLRSLIDAPANGTGPREALA
TLLQETVGELEAAQALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQ
EVGAAGGELEPKARAVLSSRLDEVLRSLVTSSFLVEKQPPQVLKTQTKFQAGVRFLLGLR
FLGAPAKPPLVRADMVTEKQARELSMPQGPGAGAESTGEIINNTVALENSIPGNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSTSLALGPNKLPVQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQK
IFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTLE
PQMPTMVPTYDLGMATESSMNMQLSPDMVSQVYPPHSHSMPSFQALSREDVLPTFQESHL
QMPPNLSQINLPFDQPHPQGLLPCQSQEHAVSTPEPLLCSDVPMTEDSCLSQPVGGFPQS
TWVGEDMFPPLLPPTEQDLTKLLLEGQGESGGGSLGTQPLLQPSHYGQSGISMSHLDLRA
NPSW
Download sequence
Identical sequences F1PAY3
ENSCAFP00000000244 ENSCAFP00000000244 XP_003431490.1.84170 XP_005625589.1.84170 9615.ENSCAFP00000000244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]