SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000292 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000292
Domain Number 1 Region: 231-302
Classification Level Classification E-value
Superfamily SH3-domain 4.59e-18
Family SH3-domain 0.00062
Further Details:      
 
Domain Number 2 Region: 81-139
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.42e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.006
Further Details:      
 
Domain Number 3 Region: 308-363
Classification Level Classification E-value
Superfamily SH3-domain 0.0000367
Family SH3-domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000292   Gene: ENSCAFG00000000201   Transcript: ENSCAFT00000000323
Sequence length 363
Comment pep:known_by_projection chromosome:CanFam3.1:10:1370676:1376886:-1 gene:ENSCAFG00000000201 transcript:ENSCAFT00000000323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEKEVLESSKPSFPAETRQSGLQRLKQLFRKESPGTKEMELPPEPQANGEAVGAGGGPI
YYIYEEEEEEEEEEEPPPEPPKLVNDKPHKFKDHFFKKPKFCDVCARMIVLNNKFGLRCK
NCKTNIHEHCQSYVEMQRCFGKIPPGFHRAYSSPLYSNQQYACVKDLSAASHNDPVFETL
RTGVIMANKERKKGQADKKNPLAAVMEEEPEPARPEEGKPQDGNPEGDKKAEKKTPDDKH
KQPGFQQSHYFVALYRFKALEKDDLDFPPGEKITVIDDSNEEWWRGKIGEKVGFFPPNFI
IRVRAGERVHRVTRSFVGNREIGQITLKKDQIVVQKGDEAGGYVKVYTGRKVGLFPTDFL
EEI
Download sequence
Identical sequences E2R3U5
ENSCAFP00000000292 9615.ENSCAFP00000000292 XP_538246.1.84170 ENSCAFP00000000292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]