SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000325 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000325
Domain Number 1 Region: 163-376
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.000053
Further Details:      
 
Domain Number 2 Region: 19-88
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000303
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000325   Gene: ENSCAFG00000000225   Transcript: ENSCAFT00000000358
Sequence length 377
Comment pep:novel chromosome:CanFam3.1:10:1576236:1581430:-1 gene:ENSCAFG00000000225 transcript:ENSCAFT00000000358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYREPPAAAPSSLWGPAGSRPESSVDLRGAALAHGRHLSSRRNVLHIRTVPGHEFLLQS
DHEAELRAWHRALRAVIERLDRENPLELRLSGSGPAELEELSGGEDDEEESEPVSKPLLR
LSGRRSSGRCPEGTEQNRVRNKLKRLIAKRPPLQSLQERGLLRDQVFGCQLESLCQREGD
TVPSFVRLCIAAVDKRGLDVDGIYRVSGNLAVVQKLRFLVDRERAITSDGRYVFPEQPGQ
EGRLDLDSAEWDDIHVVTGALKLFLRELPQPLVPPPLLPDFRAALALSESEQRISQIREL
IGSMPRPNHDTLRYLLEHLCRVIAHSDKNRMTPHNLGIVFGPTLFRPEQETSDPAAHALY
PGQLVQLMLTDFSSLFP
Download sequence
Identical sequences F1PA32
ENSCAFP00000000325 ENSCAFP00000000325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]