SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000339 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000339
Domain Number 1 Region: 588-891
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.99e-55
Family WD40-repeat 0.003
Further Details:      
 
Domain Number 2 Region: 1035-1090
Classification Level Classification E-value
Superfamily SH3-domain 5.91e-21
Family SH3-domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000339   Gene: ENSCAFG00000000234   Transcript: ENSCAFT00000000373
Sequence length 1178
Comment pep:known_by_projection chromosome:CanFam3.1:1:28008167:28198117:-1 gene:ENSCAFG00000000234 transcript:ENSCAFT00000000373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTVESEAKVKTRVRFEELLKTHHDLIQERKKLKKKIGKSGEKIALDTVRSNLQKSKETK
SDDVSSSNTTNLEKNMPGTKSKLRNSQSTPENPDDVTVEEDRQWKASKKVIKTVLQMTAQ
GMELETPMKKVDSTHQKARTKSQPGVAHQKSEKADEERENNNVDEEEELMQVYQLQVAEE
MAKEIKKKIRKKLKEQLTYFPLDTTSSLHDGKLNSEKKIKKKKKVPISSKAETSISNISN
DTVEGEQKKGSPVRTVTSDSHQDGKISSMEDNVEDSMQDDTKCKSKKKKKKAKSVSDNNE
DTDGDGVHEVTSRDSPVYPKCLLDDDLVLGVYIHRTDRLKSDFMISHPMVKIHVIDENTG
QYVKKDDSGRPVSSYYEKESVDYILPIMTQPYDFKQLKSRLPEWEEQIIFNENFPYLLRD
FDESPKVILFFEILDFLSMEEIRNNSEIQNQECGFRKIAWAFLKLLGANGNVNINSKLRL
QLYYPPTKPRFQLNVVEVFEWWSKYPRNRYPSTLYVTVRGLKVPECIKPSYRSVVAVQEE
KGKPVYCERHHETNSVDAEPGLEDSKEVVKWKRLPGQACRIPNKHLFSLNAGERGCFCLA
FSHNGRILAAACASRDGYPIILYEIPSGRFMRELCGHLNIIYDLCWSNDDRYILTASSDG
TARIWKNEINNSNTFRVLPHPSFVYTAKFHPAVKELVVTGCYDSVIRVWKVDMRENPAVL
IRQFDTHRSFINSLCFDIEGHHMYSGDCTGVIVVWNTYVKVNDVKHSVRHWSVNKEIKES
EFKGIPISYLEVHPNGKRLLIHTKDSTLRIMDLRILAARKFVGAANYREKIHSTLTPCGT
FLFAGSEDGIVYVWNPETGEQVAMYSDLPFKSPIRDISYHPLENMVAFCAFGQNEPILLY
IYDFYVAQQEAEMFKRYNGTFPLPGIHQSQDALCTCPKLPHQGSFQIDDYVHTEHSSMKM
QQVKQRLDSVTEVIRACAAKVNKNLSFASSTSSQQSKLKQSDMLAAHHIQHQFGFTQTGI
ISMERKPCNHHVDTAPTVVALYDYTANRSDELTIHRGDIIRVFFKDNEDWWYGSIGKGQE
GYFPANHVASETLYQELPPEIKERSPPLTPKGKTKTEKPSALQKQPVIKDKSQDFRLGSE
SMTHSEVGKEQSREDQGQAHKVGKEQSREDQGQAHKEK
Download sequence
Identical sequences F6XCZ4
XP_005615493.1.84170 ENSCAFP00000000339 ENSCAFP00000000339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]