SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000396 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000396
Domain Number 1 Region: 650-761
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.83e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00035
Further Details:      
 
Domain Number 2 Region: 119-290
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.78e-29
Family G proteins 0.0000000382
Further Details:      
 
Domain Number 3 Region: 390-455,590-633
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000209
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000396   Gene: ENSCAFG00000000273   Transcript: ENSCAFT00000000434
Sequence length 798
Comment pep:known_by_projection chromosome:CanFam3.1:10:1792666:1941692:-1 gene:ENSCAFG00000000273 transcript:ENSCAFT00000000434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGTPPPPRPPPRVAPAPPQGPGRAPSPREHQPLPWEPPAPGFFLGVEQSRPRSDSQRPLD
TMSGITQMNKATGGPHLAGPPPGPPGLSSGSGSRELLGAELRASPKAVVNSQEWTLSRSI
PELRLGVLGDARSGKSSLIHRFLTGSYQVLEKTESEQHKKEMLVDGQTHLVLIREEAGAP
DAKFSGWADAVILVFSLEDENSFQAVSHLHGQLTSLRGEGRGGLALALVGTQDRISASSP
RVVGDARARALCADMKRCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLLAACKSLPS
SPSHSAASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAK
RRTSLFANRRGSDSEKRSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKYVTLSS
NGFLLYHPSINDYIHSTHGKEMDLLRTTVKVPGKRPPRAISAFGPSASINGLVKDMSTVQ
MGEGPEATTPTPSPSPSPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREP
PPSPMVKKQRRKKLTTPSKTEGSAGQAEAKRKMWKLKSFGSLRNIYKAEENLEFLIVSST
GQTGHLEAASFEERDPWVQPIESQILASLQCCESSKVKLRTDSQSEAVAIQAIRNAKGNS
ICVDCGAPNPTWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELTLVLTAIGN
DVANRVWESDTRGRSKPTRDSSREERESWIRAKYEQLLFLAPLGAPEEPLGRRLWAAVQA
QDVAAVLLLLAHARHGPL
Download sequence
Identical sequences F1PGT5
ENSCAFP00000000396 ENSCAFP00000000396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]