SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000458 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000458
Domain Number 1 Region: 31-99
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000000288
Family SIAH, seven in absentia homolog 0.014
Further Details:      
 
Domain Number 2 Region: 609-655
Classification Level Classification E-value
Superfamily F-box domain 0.000000000157
Family F-box domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000458   Gene: ENSCAFG00000000330   Transcript: ENSCAFT00000000507
Sequence length 746
Comment pep:known_by_projection chromosome:CanFam3.1:1:37010033:37016986:-1 gene:ENSCAFG00000000330 transcript:ENSCAFT00000000507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEELQHSHCVNCVSRRCMTRPEPGISCDLIGCPLVCGAVFHSCKADEHRLLCPYERVPC
LNSDFGCPFTMARNKVAEHLEMCPASVVCCTMEWNRWPVSYADRKSYENLSRDVDEVAQL
DMALALQDQRMLLESLKVATMMSKATDKVSEPREQISVKSSVPEIPHANGLVSVDEESYG
ALYQATVETTRSLAAALDILNTATRDIGMLSTSLCTSPSEMNEEQNARGSLQNRHLNDQD
HLYDDEIGAVGGIDHNNTSLDVQCEQNGSSDLLCDSNTSSYGTSALCNGFSLENLCTQAM
DQNQKLYGDSKQSTLTNGECIASDGTSPPSSSLSVAAQLREALPSSALPNGTVQHILMPD
DGDEGALCWRKVDLGDLRNVDVLSLGHPPFKFLSNSCWSKPKEDKAVDTSDLEVAEDPMG
LQGIDLITAALLFCLGDSPGGRGISDSRMVDVYHIDFGTQTFSLPSAILATNTMVGEIAS
ASACDHANPQLSNPSPFQTLGLDLVLECVARYQPKQRSMFTFVCGQLFRRKEFSSHFKNV
HGDIHAGLNGWMEQRCPLAYYGCTYSQRRFCPSTQGAKIIHDRHLRSFGVQPCVSTVLVE
PARNCVLGLHSDHLSSLPFEVLQHIAGFLDGFSLCQLSCVSRLMRDVCGSLLQSRGMVIL
QWGKRKYPEGNSSWQIKEKVWRFSTAFCSVNEWKFADILSMADHLKKCSYNIVEKREEAI
PLPCMCVTRELTKEGRSLRSVLKPVL
Download sequence
Identical sequences E2R987
ENSCAFP00000000458 ENSCAFP00000000458 XP_005615542.1.84170 XP_005615543.1.84170 XP_541140.1.84170 9615.ENSCAFP00000000458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]