SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000477 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCAFP00000000477
Domain Number - Region: 10-69
Classification Level Classification E-value
Superfamily RAP domain-like 0.0628
Family RAP domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000477   Gene: ENSCAFG00000000340   Transcript: ENSCAFT00000000526
Sequence length 79
Comment pep:known_by_projection chromosome:CanFam3.1:10:6582005:6582244:-1 gene:ENSCAFG00000000340 transcript:ENSCAFT00000000526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPDLSPHLHTEECNVLINLLKECHKNHSILKFFGRCNDLDREMRKCLKNEYMEKRTKSR
EHGNAMRKRLFNPAEESEK
Download sequence
Identical sequences E2R8D2
ENSCAFP00000000477 9615.ENSCAFP00000000477 ENSCAFP00000000477 XP_005625635.1.84170 XP_538264.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]