SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000583 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000583
Domain Number 1 Region: 104-313
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.37e-62
Family DBL homology domain (DH-domain) 0.0000219
Further Details:      
 
Domain Number 2 Region: 298-439
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-31
Family Pleckstrin-homology domain (PH domain) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000583   Gene: ENSCAFG00000000405   Transcript: ENSCAFT00000000638
Sequence length 1392
Comment pep:known_by_projection chromosome:CanFam3.1:1:41129258:41297386:1 gene:ENSCAFG00000000405 transcript:ENSCAFT00000000638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSDSDRPVSFGSTSSSASSRDSHGSFGSRMTLVSNSHLGLFHQDKEAGAIKLELIPAR
PLSSSELQRAGPAGPQDTGDGGDRQPRAQRRMEANGATRAGAESATSPKLLYVDRVVQEI
LETERTYVQDLKSIVEDYLDCIRDQTKLPLGTEERSALFGNIQDIYHFNSELLQDLENCE
NDPVAIAECFVSKSEEFHIYTQYCTNYPRSVAVLTECMRNKMLAKFFRERQETLKHSLPL
GSYLLKPVQRILKYHLLLHEIENHLDKDTEGYDVVLDAIDTMQRVAWHINDMKRKHEHAV
RLQEIQSLLTNWKGPDLTSYGELVLEGTFRIQRAKNERTLFLFDKLLLITKKRDDTFTYK
AHILCGNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRLWVLHLKRLILENHAA
KIPAKAKQAILEMDAIHYPGFCYSPEGETKALCGSKDGSAPYRLRRKSEPSSRSHKVLKT
SEAAQDIQKVSREEGSPQRTSTRPSPAQRNNQPSSSAIINVLRGGGAIRNIWTDHQIRQA
LFPSRRSPQENEDDEDDYQMFVPSFSSSDLNSTRLCEDSTSSRPCSWHMGQIEPTETTSS
SHRVVRRASSAGESNTCTPEIRIRDSGGSQYSPRRELQSDPKTEGQDGMTPFGSSIELTI
DDIDHVYDNISYEDLKLMVAKREEAESTPLKIARDSVRPKSTPELAFSKKQAGHEKSSLH
TKRDGALTGCQASNQSTHELQMVEENIYDTIGLPDAPSLDFNCSSLKRPKRSTFLGLEAD
FACCDSLRPFISQDSLQFSEDEAPYHQGPSDNDYLSLLYNSFSCNLSIGDKSISDKLSEE
VDEIWNDLENYIKKNEVKARDRLLAAFPVSKDDVPDRLHSESTPELGRDAAHSVSTLSLP
EGHTFLTPLKDKPGRAGRANCPFEEDLISKEASFMSLNRLSLASETPPMENPYDLANSSS
LSQSDLEIPDAGMDVSDKTRSRVFMMARQYSQKIKKANQLLKVRSPELEQPLASQQHKST
HKDLAAILEEKKQGGPAIGARIAEYSQLYDQIVFRETPCKTQKDGWASPQEPSNLRSTSS
SQAQLSSEDWLLHSTYSNGELVDFCPRPEQDLKSKHPTLEISTKSIPRQLSTACSVPSLQ
TSDPLLCSLQRHSVIVSQPNKDNSYQGHLYNSLGRKSISAKSQPYSRSQSSSSILINKSV
DSISYPGEMGKKQPLSIHKSSRCESHQDLLPAMADPCQQGPEKHSDLTLRDSQKVLVVNR
NVPLNAQIATQNYFSNFKETEGDEDDYVEIRSEEDESEVEPSHGRRKKSDPRIAEADFSE
DPCTNSTPYSLNSPCTPKKPISDKLGISPYLASYSDSDKLNDYLWRGPSPNQQNIVQSLR
EKFQCLSSSSFA
Download sequence
Identical sequences E2R3D9
ENSCAFP00000000583 9615.ENSCAFP00000000583 ENSCAFP00000000583 XP_005615565.1.84170 XP_005615566.1.84170 XP_005615567.1.84170 XP_541152.3.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]