SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000767 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000767
Domain Number 1 Region: 617-672
Classification Level Classification E-value
Superfamily RING/U-box 0.0000848
Family RING finger domain, C3HC4 0.046
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000000767
Domain Number - Region: 497-530
Classification Level Classification E-value
Superfamily F-box domain 0.000366
Family F-box domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000767   Gene: ENSCAFG00000000544   Transcript: ENSCAFT00000000837
Sequence length 697
Comment pep:known_by_projection chromosome:CanFam3.1:13:2038408:2052426:-1 gene:ENSCAFG00000000544 transcript:ENSCAFT00000000837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KQSERFSCLEAHITTSKSSRFTDVLWKQILKMSERHSNQACTGAENEVDSPTVNFKYSSF
RDFCSTSSFQDSGYNELLQPCNFDNTDKEFFGKKEKGLTLTHEHPETPNLGLTHPLESPT
QKKRLVFSRKEHDKTPELCETPKVSGKKFLLRRRLDISFSLLNGDFDSQNSSLESSINQV
LNLEKNIPSSASSFPRQTSFSPLVTSTLKTEEATSSSQILRLNFSQQKTSTVDDSKDDCS
LFEVECLSPIQGNSFTGDSITCDLSGSSLFINNENTYPKLLGSSARGTRCGTDENICVTP
VSNLVANIKFNASQRLSPSTEVRGNISTPEDSGFNSLCLDKSEDSLSDQESSFRELQKHR
GTVKVGDTVKKSGHLRRLRRLSTLQEQSSQSETEKDSDSEATPEAASDTLEDQLSSDNKI
LSFKNLSKTPALQLVHELFMRSKRKRFQQNVAHEFLEDTDGGQIAVLQCVLAGLIGKKMG
IEKVDILTELKYRNLKHILAMVLDSLTAESLCSVWKVSRNWREIIVQDKKANRRRKFYIS
QLKTDSEGAILNVEDAATRLHLINRSALKSVQAQARIPGFQKGEVSTFSPWGEVLTPIAS
SSVTHLTSKQEEYVKVAKTLFIDEALKPCPRCQCPAKYQPFKKRGLCSRTACGFDFCVLC
LCAYHGSEECNRGAAKPRNRKDALPGSAQSKQNLRRL
Download sequence
Identical sequences F1PE00
ENSCAFP00000000767 ENSCAFP00000000767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]