SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000788 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000788
Domain Number 1 Region: 17-136
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-36
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000788   Gene: ENSCAFG00000000562   Transcript: ENSCAFT00000000861
Sequence length 428
Comment pep:known_by_projection chromosome:CanFam3.1:1:44071408:44241839:-1 gene:ENSCAFG00000000562 transcript:ENSCAFT00000000861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATDGNALQVPLRQKQRKKTQGFFTMSRRRISCKDLGHADCQGWLYKKKEKGTFLSNKWK
KFWVVLKGTSLYWYSNQMAEKADGFVNLPDFSVERASECKKKHAFKISHPQIKTFFFAAE
NAQEMSVWLNKLGLAVIHHESATKDEECYSESEQEDPEIAVETPPPPYSAETFSPLAAQQ
APSSSPKSCSCSSLESTIKTQSSLASFSRDRQSWIDMGNSSAAADNEEQSIMFAVAVRSS
APAEANSCRALENSFATSESGFLNSLSSDDTSSLSSNLDHLAVPDQPTGSKMADREETKL
SEDDEMEKLYKSLEQASLSPLGDRRPSTKKELRKSFVKRCKNPSINEKLHKIRTLNSTLK
CKEHDLAMINQLLDDPKLTARKYREWKVMNTLLIQDIYQQQRAPMSAHEGTPEGLEKPPS
SACVENSI
Download sequence
Identical sequences F1PDZ1
XP_005615590.1.84170 XP_005615591.1.84170 ENSCAFP00000000788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]