SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000806 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000806
Domain Number 1 Region: 638-812
Classification Level Classification E-value
Superfamily PH domain-like 8.34e-36
Family Phosphotyrosine-binding domain (PTB) 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000000806
Domain Number - Region: 605-645
Classification Level Classification E-value
Superfamily SH3-domain 0.00607
Family SH3-domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000806   Gene: ENSCAFG00000000568   Transcript: ENSCAFT00000000880
Sequence length 824
Comment pep:known_by_projection chromosome:CanFam3.1:10:16703287:16712278:-1 gene:ENSCAFG00000000568 transcript:ENSCAFT00000000880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADRAEMFSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEITDDCGLGLSYDSDHCEKDSL
SLGRSEQPHPICSFQDDFQEFEMIDDNEEEEEEEEEEEEEEEEEDEEEGVREGKEGGGPG
SEAPAPEALIPSPSLEEPHKNRPTTLHLTTLGAQDSLNNNGGFAPAPPASWQETALCSPP
QEPLREPPASLQPTDASPCGAQSPMHPGCDCEGNRRADAPVPCGASPSSDPGIEADLGSR
SSGGRGGRRSSQELSSPGSDSEDAVGARLGRMISSISETELELSSDGGSSSSGRSSHLTN
SIEEASSPASEPEPEPEPEPEPPRRPAFLPVGPDDTNSEYESGSESEPDLSEDADSPWLL
SNLVSRMISEGSSPIRCPGQCLSPASRPPGEPVSPAGGAGGAGCVGGPGVELLDMETLCA
PPPPEPPAPRPGPAQPGPCLFLSNPTRDTITPLWAAAGRGTRPGRACSAACSEEDEEDEE
DEAAAQAKAGRPGGRPRGPTATLDASLVYDAVKYTLVVDEHTQLELVSLRRCAGLGDDSS
EDSGEASEEDTAATLLGDQGPEDASPDSPDLTFSKKFLNVFVNSTSRSSSTESFGLFSCL
VNGEEKEQTHRAVFRFIPRHPDELELDVDDPVLVEAEEDDFWFRGFNMRTGERGVFPAFY
AHAVPGPAKDLLGSKRSPCWVERFDVQFLGSVEVPCHQGNGILCAAMQKIATARKLTVHL
RPPASCDLEISLRGVKLSLSGGPEVQHCSHFFQMKNISFCGCHPRNSCYFGFITKHPLLS
RFACHVFVSQESMRPVAQSVGRAFLEYYQEHLEYACPTEDIYLE
Download sequence
Identical sequences E2RQE0
ENSCAFP00000000806 XP_538304.2.84170 ENSCAFP00000000806 9615.ENSCAFP00000000806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]