SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000814 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000814
Domain Number 1 Region: 961-1123
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-70
Family Pleckstrin-homology domain (PH domain) 0.00000378
Further Details:      
 
Domain Number 2 Region: 749-964
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-53
Family DBL homology domain (DH-domain) 0.0000000961
Further Details:      
 
Domain Number 3 Region: 169-284
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-19
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 
Domain Number 4 Region: 526-639
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000359
Family PDZ domain 0.035
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000000814
Domain Number - Region: 297-356
Classification Level Classification E-value
Superfamily HR1 repeat 0.0942
Family HR1 repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000814   Gene: ENSCAFG00000000577   Transcript: ENSCAFT00000000892
Sequence length 1354
Comment pep:known_by_projection chromosome:CanFam3.1:1:44896837:45000582:1 gene:ENSCAFG00000000577 transcript:ENSCAFT00000000892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVPSRVERRDPAPYASLTLPCRRPKALTEDAARKDTLKARMRRISDWTGSLSRKKRKLQ
EPRSKEGSDYFDSRSDGLNADLQGPFQVSASLWPAGSAQILSQRSESAHAIGSDPLQQNI
YENFMRELEMSRTNTENVETSTDTADSSSGSLSSLEQLDLLFEKEQGVVRKAGWLFFKPL
VTLQKERKLELVARRKWKQYWVTLKGCTLLFYETYGKNSMDQSNAPRCALFAEDSIVQSV
PEHPKKENVFCLSNSFGDVYLFQATSQTDLENWVTAIHSACASLFAKKHGKEDTVRLLKN
QTKNLVQKIDMDSKMKKMAELQLSVVSDPKNRKAIENQIQQWEQNLEKFHMDLFRMRCYL
ASLQGGELPNPKSLLAAASRPSKLALGRLGILSVSSFHALVCSRDDSAFRKRTLSLTQRG
RNKKGIFSSLKGLDTLARKGKEKRPSVTQVDELLHIYGSTADGVPRDNTWEAQTYVHFQD
NQGVTVMIKPEHRVEDILTLACKMRQLEPSHYGLQLRKLVDENTEYCIPAPYEYMQEQVY
DEIEIFPLSVYDVQLTKTGSVSDFGFAVTAQVDEHQHLSRIFISDVLPDGLAYGEGLRKG
NEIMTLNGEAVSDLDLKQMEALFSEKSVGLTLIARPPDRKSTLCSSWSDSDLFSRDQKSL
LPPPNQSQLLEEFLDNFKKNTTNDFSNVPDVTSGLKRSQTDGALARVPREEDTAQTLGSA
EQITVLCRSFNDTQSNGMEGPRGTRDPPPRPLARHLSDADRLRKVIQELMDTEKSYVKDL
SCLFELYLEPLQNETFLTQDEMESLFGSLPEMLEFQKVFLETLEDGLSASSDFNILETPS
QFRKLLFSLGGSFLYYADHFKLYSGFCANHIKVQKVLERAKTDKAFKAFLDARNPTKQHS
STLESYLIKPVQRVLKYPLLLKELVSLTDHESEEHYHLTEALKAMEKVASHINEMQKIYE
DYGTVFDQLVAEQSGTEKEVTELSMGELLMHSAVSWLNPFLSLGKARKDLELTVFVFKRA
VILVYKENCKLKKKLPSNSRPAHGSADLDPFKFRWLIPISALQVRLGNTAGTENNSIWEL
IHTKSEIEGRPETIFQLCCSDNESKTNIVKVIRSILRENFRRHIKCELPLEKTCKDRLVP
LKNRVPVSAKLASSRSLKVLKTSSSSEWPSEPGKASSLDSDECSLSSSTQSSGCHPGGSR
QDCLQHPQTGLADFPDNLIKESDILSDEDEDYHQTLKQGSPTKDIELQFQRLRISDDPDA
NAAEQQPSTEGRPKGEPPKLVRGHFCAIKRKANSTKRDRGTLLKAQIRHQSLDSQSETTT
LDLSSVLQREFSVQSLTSVVNEECFYEAESHGKL
Download sequence
Identical sequences F1PBL2
ENSCAFP00000000814 ENSCAFP00000000814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]