SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000000964 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000000964
Domain Number 1 Region: 24-467
Classification Level Classification E-value
Superfamily Sema domain 1.06e-113
Family Sema domain 0.00012
Further Details:      
 
Domain Number 2 Region: 1315-1444,1621-1807
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-49
Family p120GAP domain-like 0.018
Further Details:      
 
Domain Number 3 Region: 802-896
Classification Level Classification E-value
Superfamily E set domains 3.02e-18
Family Other IPT/TIG domains 0.0068
Further Details:      
 
Domain Number 4 Region: 894-984
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000432
Family Other IPT/TIG domains 0.037
Further Details:      
 
Domain Number 5 Region: 470-520
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000136
Family Plexin repeat 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000000964
Domain Number - Region: 982-1094
Classification Level Classification E-value
Superfamily E set domains 0.000107
Family E-set domains of sugar-utilizing enzymes 0.086
Further Details:      
 
Domain Number - Region: 1468-1560
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00572
Family Ubiquitin-related 0.025
Further Details:      
 
Domain Number - Region: 765-799
Classification Level Classification E-value
Superfamily Plexin repeat 0.0075
Family Plexin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000000964   Gene: ENSCAFG00000000673   Transcript: ENSCAFT00000001052
Sequence length 1840
Comment pep:known_by_projection chromosome:CanFam3.1:10:16963409:16974381:1 gene:ENSCAFG00000000673 transcript:ENSCAFT00000001052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALQLWALTLLGLGVTGAGLRPRKLDMFRSETELNHLVVDEASGVVYLGAVNALYQLSAE
LQLEQQAATGPALDNKKCTPPIEPSQCHEAVQTDNVNQLLLLDPPGKRLVECGSLFKGIC
ALRALNNISTLLFYEDGSGEKSFVASNDESVSTVGLVSATSPGGERVLFVGKGNGPHDNG
IIVSTRLLDRTEGREAFEAYTDHATYKAGYLSANTQQFVAAFEDGLYVFFVFNQQDKHPP
RNRTLLARMCKQDPFYYSYLELDLQCRDPSDPQALRFSTCLAASVAGPGAGRVLYAVFSR
DGRSAGGPRAGLCLFPLDEVHAKMEANRNACYTGSREAGRDTFYKPFHGEIQCGGHGTGA
SESFPCGSEHLPYPLGSRDGLTATAVLQRGGLNLTAVVVTTENGHTVAFLGTSDGRVLKV
YLAPDGTSAEYGSILVEIKRIKRDLALSANLTSLYAMTQDKVFRLPVQECHIYPSCQQCR
SSQDPYCGWCVVEGRCTRRVECPRAEESGHWLWSRDEACVAVTGAQPQNMSRRAQGEVQL
TVSPLPALSEEDELLCLFGNSPAHAARVEGDVVICNSPHTIPRTPAGQDHVAVSIQLRFR
RNNTFLTSHQYPFYDCREAMSLAENLPCISCTSNRWTCQWDLRYHECREASPNPEDGIVR
AHMEDNCPQFLNPSPLVIPMNHETDVTFQGKNLETVKGSSLHVGSDLLKFEEPVSAQEPG
TFFFRTPKLSHDANETLPLHLYVKSYGKNVDSKLQVTLYNCSFGRSDCSLCLAADPAYKC
VWCAGQGRCVYEALCSNTTSECPPPVITRIHPETGPLGGGIRITILGSNLGVTADDVKRV
TVAGQNCAFEPERYSVSTRIVCAIEAAAGPITRGVTVDVNGKLGHSPPHVQFTYQQPQPL
SVDPKQGPQAGGTTLTISGTHLDTGSEEDVRVTLNDVPCKVTQFGAQLQCVTGPQSVLGE
LPLEIYYGGSRVPSPGVLFTYRENPVLRAFEPLRSFVSGGRSINVTGQGFSLIQRFAMVV
IAEPLQSWRQRREAGLLQPTTVVGTEYVFYNDSKVVFSSPAVPEEPEAYNLTALIQMDGH
RALLRTEAGAFEYVADPTFENFTGGVKKQVNKLIHARGTNLNKAMTLHEAEAFVGAERCI
MKTLTETDLYCEPPEVQPPPKRRQKRDTTHNLPEFIVKFGSREWVLGRVEYDTRASDVPL
SLILPLVIVPMVVVIAVSVYCYWRKSQQAEREYEKIKSQLEGLEESVRDRCKKEFTDLMI
EMEDQTNDVHEAGIPVLDYKTYTDRVFFLPSKDGDKDVMITGRLDIPESRRSVVEQALYQ
FSNLLNSKSFLVTFIHTLESQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLFLELME
QYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKDSAGEPLYKLFKAIKHQVEKGPVD
AVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDEGADAIPVKVLNCDTISQVKEKIIDQV
YRTQPCSRWPKADSVVLEWRPGSTAQILSDLDLTSQREGRWKRINTLMHYNVRDGATLIL
STVGVSQQPEDSQPDLPGERHALLEEENRVWHLVRLADEVDEGKSKRGSVKEKERTKAIT
EIYLTRLLSVKGTLQQFVDNFFQSVLAPGHAVPPAVKYFFDFLDEQAEKHDIKDEDTIHI
WKTNSLPLRFWVNILKNPHFIFDVHVHEVVDSSLSVIAQTFMDACTRTEHKLSRDSPSNK
LLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYT
QKYYDEIINALEEDPAAQKMQLAFRLQQIAAALENKVTDL
Download sequence
Identical sequences F1P9S5
ENSCAFP00000000964 ENSCAFP00000036093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]