SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000001228 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000001228
Domain Number 1 Region: 213-313
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.76e-28
Family Ras-binding domain, RBD 0.0000024
Further Details:      
 
Domain Number 2 Region: 4-105
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-23
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 3 Region: 965-1062
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-22
Family PDZ domain 0.0000272
Further Details:      
 
Domain Number 4 Region: 372-468
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.11e-20
Family FHA domain 0.00000289
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000001228
Domain Number - Region: 1333-1414
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0732
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000001228   Gene: ENSCAFG00000000860   Transcript: ENSCAFT00000001341
Sequence length 1789
Comment pep:known chromosome:CanFam3.1:1:55435472:55533742:1 gene:ENSCAFG00000000860 transcript:ENSCAFT00000001341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYE
VHVSGEERRLDIDEKPLVVQLNWNKDDREGRFVLKNENDALAPKKAQSNGPEKQEKEGVI
QNFKRTLSKKEKKEKKKREKEAVRQASDKDDRPFQGDDIENSRLAAEVYKDMPETSFTRT
ISNPEVVMKRRRQQKLERRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPA
DFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEMILDDDECPLQIFREWPS
DKGLLVFQLKRRPADYIPKKTKKHVDGKLVKGKERAEGSAYGSALPPEKLPYLVELSPGR
RNHFAYYNYHTYEDGSDSRDKPKLYRLQLSVTEVGTEKFDENSIQLFGSGIQPHHCDLTN
MDGVVTVTPRSMDAETYVEGQRISETTMLQSGMKVQFGASHVFKFVDPSQDHALAKRSVD
GSLTAKGPRHKPGIVQETTFDLGGDVHSGTALPTSKSTTRLDGDRVLSASSTAERGMVKP
MMRVEQQQDYRRQENRTQDAPGPELILPASIEFRESSEDSFLSAIINYTNSSTVHFKLSP
TYVLYMACRYVLSSQYRPDVSPTERTHKVIAIVNKMVSMMEGVIQKQKNIAGALAFWMAN
ASELLNFIKQDRDLSRITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSL
QRPKIDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPESGLCSHY
WGAIIRQQLGHVEAWAEKQGLELAADCHLSRIVQATTLLTMDKYAPDDIPNINSTCFKLN
SLQLQALLQNYHCAPDEPFIPTDLIENVVAVAENTADELARSDGREVQLEEDPDLQLPFL
LPEDGYSCDVVRNIPNGLQEFLDPLCQRGFCRLIPHARSPGTWTIYFEGADYESHLLREN
TELAQPLRKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAA
GDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYHGLATLLNQPSPMMQRIS
DRRGSGKPRPKSEGFELYNNSAQNGSPESPQLPWAEYTEPKKLPGDDRLMKNRADHRSSP
NVANQPPSPGGKSAYAPGTTAKITSVSTGNLCTEEQTPPPRPEAYPIPTQTYTREYFTFP
ASKSQDRMAPPQNQWPNYEEKPHMHMDNNHSSIAIQRVTRSQEELREDKAYQLERHRIEA
VLDRKSDSDMWIHQSSSVGSSTSSQEHLDHPSKAGTPASTLTKSGPGRWKTPAAVQPLPV
AGSQPVQTDLPPPPPPPPTHYAGDFDGIPTDLPLPPPPASQTGPASAQVVAAERKKREEH
QRWYEKEKARLEEERDRKRREQERKLGQMRSQSLNPAPFSPVTVPHVKPEKPSTLQRPQE
TVIRELQPQQQPRTIERRDLQYITVSKEELSSGDSLSPDPWKRDAREKLEKQQQMHIVDM
LSREIQELQNKPERSAEENDRLRKLMLEWQFQKRLQESKQKDEDDEEEEDDDVDTMLIMQ
RLEAERRARLQDEERRRQQQLEEMRKREAEDRARQEDERRRQEEERAKRDAEEKRRQEEG
YYSRLEAERRRQHAEAERRLLEPEEPGLCRPPLPRGYKLPSPSPPAAAPPPPPQRTASSL
QAQALSPDSLYTARLVAYHEEEEEEHCSLAGPNSYLGSAGTAVGTHDAYRDPRERLSKSH
EADLPGSSGAPENLTFKERQRLFSQGQDVSNKVKASRKLTELENELNTK
Download sequence
Identical sequences F1PSU6
ENSCAFP00000037787 ENSCAFP00000001228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]