SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000001348 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000001348
Domain Number 1 Region: 12-114
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 5.49e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000001348   Gene: ENSCAFG00000000943   Transcript: ENSCAFT00000001462
Sequence length 517
Comment pep:known_by_projection chromosome:CanFam3.1:10:22659066:22709681:1 gene:ENSCAFG00000000943 transcript:ENSCAFT00000001462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDPSKQDILSIFRRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLS
FIRSTELDSNWSWFQLRCMQVGGNANASSFFHQHGCATNDTNAKYNSRAAQLYRERIKSL
ASQATRKHGTDLWLDSCVVPPLTPPPKEEDFFKNEVSTYVSGTGWASAQPEVSSLPPRNV
ETTPANNEGGPEQGPSVEGLNAPTKAASEVSSIIKKKPNQAKRGLGAKKGSLGAQKVTNT
CFNEIEKQAQAVDKMKEQEDRLARAAPKEESIVSSLRLAYKDLEIQMKKDEKVNMSGKKK
IESERLGMGFGNCRSGISHSVTSDMQTIEQETPIVAKPRKKYSDDSDDSYFTSSSRYLDE
PMEFRSNSFSSWDDSSESYWKKETIKDTDTILKTTGYSDRSTARRKPDYEPVENTDEAQK
KFGNVKAISSDMYFGRQAQADYETRARLERLSASSSISSADLFDEQRKQTAGSYNLTSVL
PTAPDMAQFKQGVRSVAGKLSVFANGVMTSIQDRYGS
Download sequence
Identical sequences E2RT80
ENSCAFP00000001348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]