SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000001433 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000001433
Domain Number 1 Region: 406-724
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-87
Family p120GAP domain-like 0.0000787
Further Details:      
 
Domain Number 2 Region: 254-365
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000103
Family Synaptotagmin-like (S variant) 0.025
Further Details:      
 
Domain Number 3 Region: 205-256
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000142
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000001433   Gene: ENSCAFG00000001014   Transcript: ENSCAFT00000001558
Sequence length 1272
Comment pep:known_by_projection chromosome:CanFam3.1:12:2834776:2861101:1 gene:ENSCAFG00000001014 transcript:ENSCAFT00000001558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VHRTSLTVSVCLCPLDVRGPPMHRTQYVHSPYDRPGWNPRFCIISGNQLLMLDEDEIHPL
LIRDRRSESSRNKLLRRTVSVPVEGRPHGEHEYHLGRSRRKSVPGGKQYSMEAAPAAPFR
PSQGFLSRRLKSSIKRTKSQPKLDRTSSFRQILPRFRSADHDRARLMQSFKESHSHESLL
SPSSAAEALELNLDEDSIIKPVHSSILGQEFCFEVTTSSGTKCFACRSAAERDKWIENLQ
RAVKPNKDNSRRVDNVLKLWIIEARELPPKKRYYCELCLDDMLYARTTSKPRSASGDTVF
WGEHFEFNNLPAVRALRLHLYRDSDKKRKKDKAGYVGLVTVPVATLAGRHFTEQWYPVTL
PTGSGGSGGMGGSGGGGGSGSGSGGKGKGGCPAVRLKARYQTMSILPMELYKEFAEYVTN
HYRMLCAVLEPALNVKGKEEVASALVHILQSTGKAKDFLSDMAMSEVDRFMEREHLIFRE
NTLATKAIEEYMRLIGQKYLKDAIGEFIRALYESEENCEVDPIKCTASSLAEHQANLRMC
CELALCKVVNSHCVFPRELKEVFASWRLRCAERGREDIADRLISASLFLRFLCPAIMSPS
LFGLMQEYPDEQTSRTLTLIAKVIQNLANFSKFTSKEDFLGFMNEFLELEWGSMQQFLYE
ISNLDTLTNSSSFEGYIDLGRELSTLHALLWEVLPQLSKEALLKLGPLPRLLNDISTALR
NPNIQRQPSRQSERPRPQPVVLRGPSAEMQGYMMRDLNSSIDLQSFMARGLNSPLPPAPS
PLLSAPPPPPVAFTLLSSSLPCTLISSILAQTHPSSLFSVPTPSLLKALLPSQRGLSFLL
PTCHLPCSLPAFFKAATTAFHLSXCCSRPLNDTAGVRGDGPPSSHHHHHHHHHHRGGEPP
GDTFAPFHGYSKSEDLSSGVPKPPAASILHSHSNSDEFGPSGTDFTRRQLSLQDNLQHML
SPPQITIGPQRPAPSGPGGGSSGGGSGGGGGGQPPPLQRGKSQQLTVSAAQKPRPSSGNL
LQSPEPSYGPARPRQQSLSKEGSIGGSGGSGGGGGGGLKPSITKQHSQAPSTLNPTMPAS
ERTVAWVSNMPHLSADIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHM
SNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQVEKDSQIKSIIGRLMLVEE
ELRRDHPAMPEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQI
TENGEFRNTADH
Download sequence
Identical sequences F1PL13
ENSCAFP00000001433 ENSCAFP00000001433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]