SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000001572 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000001572
Domain Number 1 Region: 281-486
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.85e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000001572   Gene: ENSCAFG00000001114   Transcript: ENSCAFT00000001707
Sequence length 626
Comment pep:known_by_projection chromosome:CanFam3.1:1:68145106:68201230:-1 gene:ENSCAFG00000001114 transcript:ENSCAFT00000001707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRKYGQCTMNQEITKVTEKPPFDRSGSQDSLDELSMEDYWTEVENIKKSSENRQDQEVVV
VNEPDEGELEEEWLKEAGLSNLFGESAGDPQESMVFLSTLTRTQAAAVQKRVETVSQTLR
KKNKQYQIPDVRDIFAQQRESKEKAPDGTDLQSVRTDENKHQGKDDQASSLVVGEKELTP
LVPEEAPASETDINLEVSFAEQAVNQENSKEKPQKSKGNDASLPNFRLPKDKTGTTRIGD
LAPQDMKKVCRLALIELTALYDVLGVELKQQKAVKIKTKADSGLFCIPLTVLLEHDQRKV
PGTRIPLIFQKLIARIEEGGLETEGLLRIPGAATRIRNLCQELEAKFYEGTFNWESVKQH
DAASLLKLFIRELPQPLLSVEYLRAFQAVQDLPTRKQQLQALNLLVILLPDANRDTLKAL
LEFLQRVIDNREKNKMTTMNVAMVMAPNLFMCHALGLKSNEQREFIMAAGTANIMHLLIK
YQQLLWTIPKFIVNQVRKQNTENHKKDKKAMKKLLKKMAYDREKYEKQDKNTNDADVPQG
VIRVQAPHLSKVSMAIQLTEELKASDVLARFLSQESGIAQTLKKGEVFLYEIGGNIGERC
LDDDAYMKDLFQLNPSAEWVIKSKPS
Download sequence
Identical sequences F1PVX8
ENSCAFP00000001572 ENSCAFP00000001572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]