SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000001649 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000001649
Domain Number 1 Region: 5352-5472
Classification Level Classification E-value
Superfamily PH domain-like 6.57e-32
Family Pleckstrin-homology domain (PH domain) 0.00075
Further Details:      
 
Domain Number 2 Region: 5149-5343
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-28
Family DBL homology domain (DH-domain) 0.00039
Further Details:      
 
Domain Number 3 Region: 4583-4679
Classification Level Classification E-value
Superfamily Immunoglobulin 1.3e-23
Family I set domains 0.0049
Further Details:      
 
Domain Number 4 Region: 3939-4050
Classification Level Classification E-value
Superfamily Fibronectin type III 4.24e-23
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 5 Region: 8-98
Classification Level Classification E-value
Superfamily Immunoglobulin 5.85e-22
Family I set domains 0.0043
Further Details:      
 
Domain Number 6 Region: 5474-5575
Classification Level Classification E-value
Superfamily Immunoglobulin 1.09e-21
Family I set domains 0.0044
Further Details:      
 
Domain Number 7 Region: 5568-5665
Classification Level Classification E-value
Superfamily Immunoglobulin 6.39e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 8 Region: 107-200
Classification Level Classification E-value
Superfamily Immunoglobulin 6.98e-20
Family I set domains 0.0098
Further Details:      
 
Domain Number 9 Region: 238-329
Classification Level Classification E-value
Superfamily Immunoglobulin 2.45e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 10 Region: 1881-1974
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-18
Family I set domains 0.023
Further Details:      
 
Domain Number 11 Region: 2865-2958
Classification Level Classification E-value
Superfamily Immunoglobulin 1.2e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 12 Region: 4355-4448
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-18
Family I set domains 0.0056
Further Details:      
 
Domain Number 13 Region: 2416-2509
Classification Level Classification E-value
Superfamily Immunoglobulin 2.54e-18
Family I set domains 0.027
Further Details:      
 
Domain Number 14 Region: 2059-2152
Classification Level Classification E-value
Superfamily Immunoglobulin 3.62e-18
Family I set domains 0.054
Further Details:      
 
Domain Number 15 Region: 4831-4933
Classification Level Classification E-value
Superfamily Immunoglobulin 3.92e-18
Family I set domains 0.0068
Further Details:      
 
Domain Number 16 Region: 3307-3400
Classification Level Classification E-value
Superfamily Immunoglobulin 8.02e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 17 Region: 4723-4823
Classification Level Classification E-value
Superfamily Immunoglobulin 8.55e-18
Family I set domains 0.0038
Further Details:      
 
Domain Number 18 Region: 877-974
Classification Level Classification E-value
Superfamily Immunoglobulin 1.09e-17
Family I set domains 0.015
Further Details:      
 
Domain Number 19 Region: 969-1066
Classification Level Classification E-value
Superfamily Immunoglobulin 2.51e-17
Family I set domains 0.012
Further Details:      
 
Domain Number 20 Region: 1061-1157
Classification Level Classification E-value
Superfamily Immunoglobulin 5.27e-17
Family I set domains 0.012
Further Details:      
 
Domain Number 21 Region: 1246-1341
Classification Level Classification E-value
Superfamily Immunoglobulin 6.69e-17
Family I set domains 0.012
Further Details:      
 
Domain Number 22 Region: 1154-1249
Classification Level Classification E-value
Superfamily Immunoglobulin 6.69e-17
Family I set domains 0.012
Further Details:      
 
Domain Number 23 Region: 2600-2687
Classification Level Classification E-value
Superfamily Immunoglobulin 1.04e-16
Family I set domains 0.0097
Further Details:      
 
Domain Number 24 Region: 2238-2331
Classification Level Classification E-value
Superfamily Immunoglobulin 3.67e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 25 Region: 3491-3581
Classification Level Classification E-value
Superfamily Immunoglobulin 6.51e-16
Family I set domains 0.028
Further Details:      
 
Domain Number 26 Region: 2961-3050
Classification Level Classification E-value
Superfamily Immunoglobulin 6.57e-16
Family V set domains (antibody variable domain-like) 0.068
Further Details:      
 
Domain Number 27 Region: 1529-1616
Classification Level Classification E-value
Superfamily Immunoglobulin 9.06e-16
Family I set domains 0.016
Further Details:      
 
Domain Number 28 Region: 1338-1426
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000155
Family I set domains 0.014
Further Details:      
 
Domain Number 29 Region: 3219-3311
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000158
Family I set domains 0.041
Further Details:      
 
Domain Number 30 Region: 3138-3226
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000258
Family I set domains 0.029
Further Details:      
 
Domain Number 31 Region: 499-603
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000286
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 32 Region: 3050-3139
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000301
Family I set domains 0.039
Further Details:      
 
Domain Number 33 Region: 1622-1704
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000425
Family I set domains 0.02
Further Details:      
 
Domain Number 34 Region: 3576-3672
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000018
Family I set domains 0.022
Further Details:      
 
Domain Number 35 Region: 3396-3489
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000215
Family I set domains 0.014
Further Details:      
 
Domain Number 36 Region: 2685-2778
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000255
Family I set domains 0.016
Further Details:      
 
Domain Number 37 Region: 2784-2874
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000593
Family I set domains 0.018
Further Details:      
 
Domain Number 38 Region: 1980-2072
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000708
Family I set domains 0.0064
Further Details:      
 
Domain Number 39 Region: 804-884
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000105
Family I set domains 0.021
Further Details:      
 
Domain Number 40 Region: 1703-1796
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000692
Family I set domains 0.013
Further Details:      
 
Domain Number 41 Region: 3859-3951
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000109
Family I set domains 0.022
Further Details:      
 
Domain Number 42 Region: 323-410
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000127
Family I set domains 0.016
Further Details:      
 
Domain Number 43 Region: 3667-3762
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000131
Family I set domains 0.0081
Further Details:      
 
Domain Number 44 Region: 422-502
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000147
Family I set domains 0.013
Further Details:      
 
Domain Number 45 Region: 1438-1518
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000024
Family I set domains 0.016
Further Details:      
 
Domain Number 46 Region: 4079-4171
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000439
Family I set domains 0.013
Further Details:      
 
Domain Number 47 Region: 704-777
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000469
Family I set domains 0.019
Further Details:      
 
Domain Number 48 Region: 2336-2423
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000094
Family I set domains 0.01
Further Details:      
 
Domain Number 49 Region: 3759-3853
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000835
Family I set domains 0.02
Further Details:      
 
Domain Number 50 Region: 1792-1885
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000047
Family I set domains 0.006
Further Details:      
 
Domain Number 51 Region: 2515-2609
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000687
Family I set domains 0.02
Further Details:      
 
Domain Number 52 Region: 5065-5128
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000067
Family SH3-domain 0.0042
Further Details:      
 
Domain Number 53 Region: 2158-2251
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000013
Family I set domains 0.016
Further Details:      
 
Domain Number 54 Region: 604-674
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000188
Family I set domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000001649   Gene: ENSCAFG00000001161   Transcript: ENSCAFT00000001792
Sequence length 5738
Comment pep:known_by_projection chromosome:CanFam3.1:14:676527:779385:-1 gene:ENSCAFG00000001161 transcript:ENSCAFT00000001792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHSFSGAPRFLTRPKAFVVSVGKDATLSCQIVGNPTPQVSWEKDQLPVEEGARFRLAQD
GDLYRLTILDLALGDSGQYVCRARNAIGEAFAAVGLQVDAEAACAEQAPHFLLRPTSIRV
REGAEATFRCRVRGSPPMAVSWAKDGRRLGAPDEPRVRVEALGEASALRIRDARPRDGGT
YTVRAENPLGAASADAALTVDADADAASPPGASTAALLAHLQRRREAMRAEGAPASPPGS
GTRTCTVTEGKHARLSCYVTGEPKPETVWKKDGQLVVEGRRHVVYEDAQENFVLKILFCK
QSDRGLYTCTASNLVGQTYSSVLVVVRERTMPFKKRLHDLQVQEKESATFQCEVPLPSTE
AAWYKEETRLWASAKYGIEEAGTERRLTVRNVSADDDAVYICETAEGSRTVAELAVQGNL
VRRLPRKTAVRVGDTAMFCVELARPEDPVHWLRNQEEVVAGGRVAITTDGRCHTLTISKC
TLEDVGEVTFTAGDCRTSTQFFVSAPRKLPLQAPEAPVVKARTECSVTLGWSPPPHGDRP
VPIDGYVVEKKRLGAYTWSRCHEAEWVATQELTIANMSEEGNFQFRVSAVNSFGHSPYLE
FPGTVHLAPQLAVKTPLKAVAAVEGSEVTFSVDLTLASAGEWFLDGQALKASSMYVIRQD
GTRHTLTIRAVSASLQGAELKFMANGIESSIRMEVREAPGLTARPPVATVREVLAQLHEE
AQLLAELSDQAAAVTWLKDGHVLPPGPKYEVQASAGQRTLLVRDVVRDDAGLYECISNGG
RIAYQLSVQGLTPFLRKDTAGGCVEAVAGGLAHFECETSEAHVRVRWYKDGMELSRSSQR
FSQEDVGTRHRLVAASVSRQDEGTYSCRVGEDSVDFQLLVSEPTPVFAKEQPARSEVQAK
AGGSATLSCEVAQAGTEVTWYKDGKKLSASSRVHVEAQGCSRRLVVQQAGRADAGEYSCE
AGGQKVSFHLHVAEPSAVFAKEQPARSEVQAKAGGSATLSCEVAQAGTEVTWYKDGKKLS
ASSRVHVEAQGCSRRLVVQQAGRADAGEYSCEAGGQKVSFRLDVTEPSVEFAKEQPARSE
VQAKAGGSATLSCEVAQAGTEVTWYKDGKKLSASSRVHVEAQGCSRRLVVQQAGRADAGE
YSCEAGGQKVSFRLDVAEPTPVFAKEQPARSEVQAKAGGSATLSCEVAQAGTEVTWYKDG
KKLSASSRVHVEAQGCSRRLVVQQAGRADAGEYSCEAGGQKVSFRLDVAEPTPVFAKEQP
ARSEVQAKAGGSATLSCEVAQAGTEVTWYKDGKKLSASSRVHVEAQGCSRRLVVQQAGRA
DAGEYSCEAGGQKVSFRLDVAEPTPVFAKEQPARSEVQAKAGGSATLSCEVAQAGTEVTW
YKDGKKLSASSRVHVEAQGCSRRLVVQQAGRADAGEYSCEAGGQKVFFSLEFAEREPEPP
TLQKPGRREPLVVREHEDIFLTATLATPSVAAVTWLKDGVEIRRSKRHEMASLGVTHTLK
IRGAQTLDSAVYSCRVGTEGQDFPVQVEEVAAKFCQHLEPASGELGGTVTLACELSPPQA
EVVWRHGSAQLRAGKRFRMEAAGPRRTLTLSGLRLEDAGEYACETRDDRTSAQLTVSAPR
MVKFTSGLSAAVAEEGSEATFQCVVSPSDAAVSWFRDGALLQPSEKFLISQSGASHSLTV
CSLTLEDSGQITVEAEGVLSSAALRVREAPVLFRKKLEPQTVEERSLVTMEVELTRPWPE
VKWTRNATALAPGKNVEIHAESTSHRLILRCVGFADRGFYGCETPDDKTQAKLTVEMRQV
RLVRGLQAVEASEQGTVSMEVELSHDDVEGSWTHDGLRLQPGPTCQLAVHGPIHTLTLFG
LRPQDSGLIAFKAEGVHTSARLVVTELPVRFSRPLQDIVATEKDKVTLECELSRPNVDVR
WLKDGVELRVGKTVGMVAQGACRSLIIYRCELRDQGVYVCDAHDTQSSASLKVQGRKVQI
VRPLEDVEVMEKEGATFSCEVSLDEVPAEWFWEGSKLRPSDNVRIRQEGRTHTLIYRRVL
VEDAGEIKFVVETAESRAQLRVKELPVTILRPLRDKIAMEKHRGVLECQMSRASAQVQWF
KGSVELHSGPKYEMVSDGLYRKLVIKDVQPEDEDTYTCDAGDVKTSAQFFVEEQSITIVR
GLQDMTVMEPAPAWFECETSIPSVRPPKWLLGKTVLQAGANVGMEQEGTVHRLTLRRTCS
TMTGPVHFTIGKSRSTARLVVSDIPMVLTRPLEPKAGRELQSVVLSCDFKPPPKAVQWYK
EDTPLAPSEKFKMMLEGHMAELRILRLTPADAGIYRCQAGSAQSSAQVTVEAREVTVTQP
LQDAQVTEEGRACFSCELSHEDEEVEWSLNGAPLYNDSFHEITHEGRCHTLVLKRVRRVD
TGTVRVSSPKVSATARLEVKAKPVVFLKALDDVSAEERGTLALQCEVSDPQACVVWRKDD
VELGPSDKYDFLHTAGTRGLVVHDLSRDDTGLYTCSVGLEETRAQVIVHDLHVGITKRLK
TVEVLEGQSCSFECVLSHESTGDAATWTVGGKMVGDSGRFRATRQGRKYTLAVRDAAASD
AGEVVFSMRDLTSKASLIVRERPVDITKPLEDQRAAPGDDVVLSCELSRASTPVRWLRDG
KSIRNSQKYELVTEGTRAMLVVHAVSLRDSGQYSCETEASKTTATVCVEEKANRFMEELA
DVQVEEKGTAVFMCKTEHPAAMVTWRKGVTELHASRKHVPSQEGLTLKLTINALEKADSD
TYTCDIGQASSQARLLVQGQRVLITEALEDVEVREGASATFSCRISPADYGPVHWFLDKT
PLHPNELNEIEVQPGGYHVLTLRQLALKDSGTIHFEAGDQRASATLRVTEKPSVFSRELT
DTTVTEGEELTLVCEITTLDGSVCWTKDGKVLRPSARCQLSQEGHRAQLIITGATMQDGG
RYKCEAGDSWSSSIVRVHARPVCFREGLQDLDVLEGSAATLRCVLSTVAAPVQWRRGDEV
LRPGGKYSMRQDGPVLELVVRDLRPQDSGQYSCCFGDQMTLATLNVKAQPTEFIGRLRNK
EATEGATATLRCELSKAAPVEWRKGPEALRAGDRVSLRQDGAVCELQIRGLAVEDSGEYS
CVCGQERTAAVLTVRALPAKFTKGLRKEEATEGATATLRCELSKAAPVEWRKGPEALRAG
DRVSLRQDGAVCELQIRGLAVEDSGEYSCVCGQERTAAVLTVRELPTKFTKSLRNEEASE
GATATLRCELSKAAPVEWRKGPEALRAGDRVSLRQDGAVCELQIRGLAMEDSGEYSCVCG
QERTAAVLTVRAAQVVFKEPLRSLQAKEGTSVTLRCELSQPGATVVWSKGGLELQADSRR
EPRQQGPTVELVLRDLHRGDSGEYTCACGLQSTSATLTITAAPVQFLRELEAQEVDEGAT
ACLRCELSQECASVDWRKGSLQLFPCAKYQMVQKGTTVELLVRSAEQEDAGHYTCDTGHT
QSTASLSVRACRPVFQEELQSTEQEAGGVAWLHCQLSKAETDVPVQWLKEGVELHLSPKY
EIRRVGTTCELLIHGLEPKDTGEYVCVAGGQKPMASVMVKEPEVTIVRGLVDAEVQVDGD
VEFSCEVSRAGVTNVEWRLQGLPLQSNEVTEVSVRGGRTHMLQLKGVTPEDAGTVSFHVG
MHTSSAQLTVRVPEVTIVEALQDVQLSEGQDAHFRCQLSRASGQEAHWALGGVPLKANEM
NDITVEHGTLHLLTLHKVTLEDAGTISFQVGSCSSEAQLKVTAKNTVVRGLENVDTLEGG
EALFECQLSRPEVAAHTWLLDDEPVHTSENAEVVYFENGLRHLLLLKNLRPQDSCRVTFL
AGDVVTSAFLTVRGWRLDVLESPQDASVRVGGPARFTCTLSEAVPVGEATWYINGAAVQP
DDPDWTVTADGSHHALLLRGAQPHHAGEVTFAAHDAVASARLTVLSLPDPPEDAEVVAQS
GRSVTLSWVAPASDGGGGLCGYRVEMKAATTGEWQLCHELVPGPECIVDGLAPGESYRFR
VAAVGPVGAGEPVHLPQTVRLEPPAPAPPAPETRAPAPPTLVPPAPETRAPAHPVPAPLA
PMLPAPETRQVGAGEDLCLECEVAEAGEVVWLKGTELIQPGGRVQVLCRGQQHTLVIRGF
SAEDQGEYCCSPAWDPTSSAATASFQVELTPGSRDEAPVQPSLPPEAAQEGDLHLLWEAL
ARKRRMSREPTLDSISELPEEDGRVQRLRQEAEEAAPDLSEDYSTADELARTGEADLSHT
SSDDESRAGTPSLVTYLKKAGRPSTSPPASKVGVPTVPSGRPQKHQEQPAAARSAPADLR
AEDLSDPSMDKAAVKIQAAFKGYKVRKEMKQQEGPAFSRTFRDTEVQVGDVLRLECVVSS
KADVRACWLKDGVELTDGRHHHIDQLGDGTCSLLVTGLGRADAGRYTCQVSSKFGHVAHS
ACVVVSGTESEAESSSGGELDDAFRRAARRLHRLFRTKSPTEVSDEEIFVSADEGPAEPQ
EPQEPGDWQTYHEDERFVYIRFESLAESQRAAACFREMFGTMGIGVDISLSEQGPRGVEM
RISKVAPAPAAPQERALPALPALTSEAAPVFLTELQNQEVLDGYPVSFDCVVAGQPVPTV
CWFKDGRMLEEDDHYMISEDQQGGHQLIITAVVPADMGVYRCMAENSVGVSSTKAELRVD
LTSTDYETAADATETSSYFSAQGYLSSREQEGTESTSEEGQLPQVVEELKDLQVAPGTRL
AKFQVKVKGYPAPRLYWFKDGQPLTASEHIHMADRKTLHTLEVVSVTCEDDGQYSAYISN
AVGAAYSSARLIVRGPKDPEEKPASDVQQQLVPPRFLERFTSKKVKKGSSITFSVKVEGF
PAPAVHWLREEAERGVLWIGRDTPGYTVASSAQQHSLVLLDVGRPHQGTYTCIATNAAGQ
ALCSASLHVSGLPKETRVAEEHAGVKEALISTFLQGTQAISTQMSEPVGFADLAGQRKEP
TAVEARGHLSLSEVGTEEFLQKLTSQITEIVSAKITHAKLQVPGGDSDEESKTPSASPWH
GRSRPSSSVQESSSESEDGDSRGEIFDIYVVTADYLPLGAEQDALSLREGQYVEVLDSAH
PLRWLVRTKPTKSSPSRQGWVSPAYLDRRLKLSPEWGPTEAPEFPGEAVSEDEYKTRLSS
IIQDLLSSEQTFVGKLQFLQSHHVQHLDRCPHVPTAVASQKAVIFRNVQDICRFHSSFQR
ELQSCDTDDDVAMCFIKNQAAFEQYLAFLVGRVQAESAVVSPAVQEFYKKYTEEVLSAAD
PSQPPPPPLQHFLEQPVERVQQYQALLKELIRNKARNAQNCALLEQAYAVVSALPQRAEN
QLHLSLMENYPGTLEALGEPIRQGHFIVWEGAPGARMPWKGHHRHVFLFRHHLLVCKPRR
DSRTDTFSYVFRNMMKLSSIDLNDQVEGDDRAFEVWHEREDSVRKYVLQARTVITKSSWV
KEICGLQQRLALPVWHPPDFEEELADCTAELGETVKLACRVTGTPKPIVSWYKDGKPVEV
DPHHILIEDPDGSCALILDNLTGVDSGQYMCFAASASGNASTLGKILVQVPPRFVKKVRA
VPFVEGEDAQVTCTIEGAPHPQIRWYKDGALLTPSSKYRTLSEPRSGLLVLEILAASKED
LGHYECELVNQLGSVRGGAELCVQSPVVRAREQLHREQLAAVEVTEQETKVPKKTVIIRC
CLSSCPGASRPGDHVCPKDAGVPRGSRTLHRGPCQPWP
Download sequence
Identical sequences E2RLJ0
ENSCAFP00000001649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]