SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000001739 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000001739
Domain Number 1 Region: 425-715
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-82
Family Protein kinases, catalytic subunit 0.000000000129
Further Details:      
 
Domain Number 2 Region: 924-1061
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 2.35e-59
Family FAT domain of focal adhesion kinase 0.000000192
Further Details:      
 
Domain Number 3 Region: 148-269
Classification Level Classification E-value
Superfamily Second domain of FERM 1.07e-39
Family Second domain of FERM 0.0000005
Further Details:      
 
Domain Number 4 Region: 47-146
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.65e-39
Family First domain of FERM 0.00000228
Further Details:      
 
Domain Number 5 Region: 270-378
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-37
Family Third domain of FERM 0.00000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000001739   Gene: ENSCAFG00000001217   Transcript: ENSCAFT00000001888
Sequence length 1068
Comment pep:known_by_projection chromosome:CanFam3.1:13:35303499:35479722:-1 gene:ENSCAFG00000001217 transcript:ENSCAFT00000001888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLCLLEYDRYIASSKIMAAAYLDPNLNHTPNSSTKTHLGAGVERSPGAMERVLKVFHYFE
NSSEPATWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHLDMGV
SNVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMSEIADRVD
QDIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPRSLLDSVKAKTLRKLI
QQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLT
DKGCNPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLI
DGYCRLVNGATQSFIIRPQKEGERALPSIPKLANSEKQGVRTHAVSVSETDDYAEIIDEE
DTYTMPSTRDYEIQRERIELGRCIGEGQFGDVHQGVYMSPENPALAVAIKTCKNCTSDSV
REKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLI
LYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKL
PIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMP
PNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKVQQEERMRMESRRQVTVSWD
SGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPASHGIPAMAGSIYPGQ
ASLLDQTDSWNHRPQEISMWQPNMEDSAALDLRGIGQVLPTHLMEERLIRQQQEMEEDQR
WLEKEERFLKPDVRLSRGSIDREDGSLQGPTGNQHIYQPVGKPDPAAPPKKPPRPGAPGH
LGSLASLSSPGDSYNEGVKLQPQEISPPPTANLDRSNDRVYENVTGLVKAVIEMSSKIQP
APPEEYVPMVKEVGLALRTLLATVDETLPVLPASTHREIEMAQKLLNSDLGELINKMKLA
QQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLRMLGPTRPH
Download sequence
Identical sequences E2RGP8
ENSCAFP00000001739 ENSCAFP00000001739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]