SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000001830 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000001830
Domain Number 1 Region: 8-33,70-291
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.06e-62
Family Ankyrin repeat 0.0000351
Further Details:      
 
Domain Number 2 Region: 907-1068
Classification Level Classification E-value
Superfamily PH domain-like 1.22e-44
Family Phosphotyrosine-binding domain (PTB) 0.0029
Further Details:      
 
Domain Number 3 Region: 696-764
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.73e-16
Family SAM (sterile alpha motif) domain 0.0033
Further Details:      
 
Domain Number 4 Region: 770-840
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000766
Family SAM (sterile alpha motif) domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000001830   Gene: ENSCAFG00000001277   Transcript: ENSCAFT00000001982
Sequence length 1135
Comment pep:known_by_projection chromosome:CanFam3.1:12:4095490:4270355:1 gene:ENSCAFG00000001277 transcript:ENSCAFT00000001982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKEQELLEAARTGHLPAVEKLLSGKRLSSGFGGGGGGGSGSSGSGGGGGGGGGLGSSSH
PLSSLLSIWRGPNVNCVDSTGYTPLHHAALNGHKDVVEVLLRNDALTNVADSKGCYPLHL
AAWKGDAQIVRLLIHQGPSHTRVNEQNNDNETALHCAAQYGHTEVVKVLLEELTDPTMRN
NKFETPLDLAALYGRLEVVKMLLNAHPNLLSCNTKKHTPLHLAARNGHKAVVQVLLDAGM
DSNYQTEKGSALHEAALFGKTDVVQILLAAGIDVNIKDNRGLTALDTVRELPSQKSQQIA
ALIEDHMTGKRSAKEVDKTLRSQGPLISNMDSISQKSQGDVEKAVTELIIDFDTNAEEEG
PYEALYNAVSCHSLDSMASGRSSDRDSVNKETEAAGVKAAGVRPRERPPPPAKPPPDEEE
EERIDKKYFPLTASEVLAMRPWIQGSAAREEDEHPYELLLTAETKKLGSMDGPLQDHRRS
SSSRSQDSAEGQDGQVPEQFSGLLHGSSPVCEVGQDPFQLLSATGQSHPEGSPAQGACHE
ASMQLEETGVHAPGASPPSVLDQGKRVGYPAGLPTTTSQSHPETLTHTASQHPGGAEEEK
DRSGTRSRAPPTSKPKAELKLSRSLSKSDSDLLTCSPTEDTTMGSRSESLSNCSIGKKRL
EKSPSFASEWDEIEKIMSSIGEGIDFSQEQKKISGSRTLEQSVGEWLEAVGLQQYESKLL
LNGFDDVRFLGSNVMEEQDLRDIGITDPQHRRKLLQAAKSLPKVKALGYDGNSPPSVPSW
LDSLGLQDYVHSFLSSGYSSIDTVKNLWELELVNVLKVHLLGHRKRIIASLADRPYEEPP
QKPPRFSQLRCQDLLSQTSSPLSQNDSCTGRSADLLLPPGDTGKRRHDSLHDPAAPSRAE
RFRVQEEQREAKLTLRPPSLAAPYAPVQSWQHQPEKLIFESCGYEANYLGSMLIKDLRGT
ESTQDACAKMRKSTEHMKKIPTIILSITYKGVKFIDASNKNVIAEHEIRNISCAAQDPED
LCTFAYITKDLQTSHHYCHVFSTVDVNLTYEIILTLGQAFEVAYQLALQAQKSRPLGASA
AETIETKSSKPVPKPRVGTRKSALEPPDLDPDTQSHASVSWVVDPKPDSKRSLST
Download sequence
Identical sequences F1PND5
ENSCAFP00000001830 ENSCAFP00000001830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]