SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000002088 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000002088
Domain Number 1 Region: 86-309
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-57
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 320-470
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-30
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 
Domain Number 3 Region: 455-521
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 9.78e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0021
Further Details:      
 
Domain Number 4 Region: 548-642
Classification Level Classification E-value
Superfamily PH domain-like 1.75e-20
Family Pleckstrin-homology domain (PH domain) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000002088   Gene: ENSCAFG00000001444   Transcript: ENSCAFT00000002252
Sequence length 657
Comment pep:known_by_projection chromosome:CanFam3.1:12:6069462:6091747:1 gene:ENSCAFG00000001444 transcript:ENSCAFT00000002252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGESKEKLASVSNLVTVFENSRIPGAASSVSKLEIEHHHPGCRSPPPAEPLKEPNLGET
LRGSEPRMVSRRYLSSLKNKLSSGAWRKSCQPGTDPGPGTQEPEEKRIVQELLETEKAYV
ARLHLLDQVFFQELLREARSSKAFPEDVVRLIFSNISSIYQFHAQFFLPELQRRLDDWTA
TPRIGDVIQKLAPFLKMYSEYVKNFERAAELLATWTDKSAPFQEVITRIQSSEASGSLTL
QHHMLEPVQRIPRYELLLKEYVQKLPAQAPDRADAQKALDMIFSAAQHSNAAISEMERLQ
DLWEVYQRLGLEGDIVDPSNTLLREGPVLKISFRRSDPMERYLFLFNNMLLYCIPKVIQV
GAQFQVRTRIDVAGMKVRELTDAEFPHSFLVSGKQRTLELQARSQEEMISWMQACQAAID
QIEKRNETFKAAVQGPEGDTQEQELQSEELGLRAPQWVRDKMVTMCMRCREPFNALRRRR
HHCRACGFVVCAKCSDYRAELKYDDNRPNRVCFHCYTFLTGNVLPEDREDRRRGILEPGS
MTGSEQSLMCSFLQLVGDKWGKSSPRGWCVIPRDDPLVLYVYAAPQDMRAHTSIPLLGYQ
VTAGTQADPRVFQLQQSGQLYTFKAETEELRDRWVKAMERAASGWSPRGPKDGDLSD
Download sequence
Identical sequences E2RP97
ENSCAFP00000002088 ENSCAFP00000041258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]