SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000002357 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000002357
Domain Number 1 Region: 126-254
Classification Level Classification E-value
Superfamily Cyclin-like 9.01e-42
Family Cyclin 0.00027
Further Details:      
 
Domain Number 2 Region: 256-353
Classification Level Classification E-value
Superfamily Cyclin-like 1.84e-33
Family Cyclin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000002357   Gene: ENSCAFG00000001618   Transcript: ENSCAFT00000002538
Sequence length 394
Comment pep:known_by_projection chromosome:CanFam3.1:12:10594818:10600891:-1 gene:ENSCAFG00000001618 transcript:ENSCAFT00000002538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPPGGGGGRPASPFRPGLRRPRPAPRRAARAFHGCYIVARGGAPVREAARAPARAGWGS
ARSASASASARPAPRAPRPALSGRRRLPPASPPARPRARCPIMELLCCEGTRHAPRAGPD
PRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVF
PLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHSVSPRQLR
DWEVLVLGKLKWDLAAVIAHDFLALILHRLSLPQDRQALVKKHAQTFLALCATDYTFAMY
PPSMIATGSIGAAVQGLGACSTSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREA
AQTSPSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
Download sequence
Identical sequences F1PC17
ENSCAFP00000002357 ENSCAFP00000002357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]